Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafQ-relB/YafQ-DinJ |
Location | 2457223..2457754 | Replicon | chromosome |
Accession | NZ_CP113925 | ||
Organism | Bifidobacterium sp. ESL0728 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | - |
Locus tag | OZX67_RS09155 | Protein ID | WP_277142816.1 |
Coordinates | 2457473..2457754 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OZX67_RS09150 | Protein ID | WP_277142814.1 |
Coordinates | 2457223..2457480 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZX67_RS09130 (OZX67_09130) | 2452501..2452704 | - | 204 | WP_277142805.1 | hypothetical protein | - |
OZX67_RS09135 (OZX67_09135) | 2453099..2454649 | - | 1551 | WP_277142807.1 | amino acid permease | - |
OZX67_RS09140 (OZX67_09140) | 2455193..2455465 | + | 273 | WP_277142809.1 | hypothetical protein | - |
OZX67_RS09145 (OZX67_09145) | 2455462..2457009 | + | 1548 | WP_277142812.1 | amino acid permease | - |
OZX67_RS09150 (OZX67_09150) | 2457223..2457480 | + | 258 | WP_277142814.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OZX67_RS09155 (OZX67_09155) | 2457473..2457754 | + | 282 | WP_277142816.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
OZX67_RS09160 (OZX67_09160) | 2457953..2458324 | - | 372 | WP_277142818.1 | hypothetical protein | - |
OZX67_RS09165 (OZX67_09165) | 2458846..2459901 | - | 1056 | WP_277142821.1 | ketol-acid reductoisomerase | - |
OZX67_RS09170 (OZX67_09170) | 2460270..2461568 | - | 1299 | WP_277145072.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11081.78 Da Isoelectric Point: 10.2227
>T266169 WP_277142816.1 NZ_CP113925:2457473-2457754 [Bifidobacterium sp. ESL0728]
MLDSVFRTSQFKRDFKALVRKHYNPETMRAAVSALMGQNKDLLRTKYRDHPLTGEWKGYREIHLEGDWLVIYRIKKTELQ
LVLTRTGSHDDLF
MLDSVFRTSQFKRDFKALVRKHYNPETMRAAVSALMGQNKDLLRTKYRDHPLTGEWKGYREIHLEGDWLVIYRIKKTELQ
LVLTRTGSHDDLF
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|