Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafQ-relB/YafQ-DinJ |
Location | 2389374..2389905 | Replicon | chromosome |
Accession | NZ_CP113925 | ||
Organism | Bifidobacterium sp. ESL0728 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | - |
Locus tag | OZX67_RS08940 | Protein ID | WP_277142730.1 |
Coordinates | 2389618..2389905 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OZX67_RS08935 | Protein ID | WP_277142728.1 |
Coordinates | 2389374..2389625 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZX67_RS08925 (OZX67_08925) | 2385144..2386208 | + | 1065 | WP_277142723.1 | 2,3-butanediol dehydrogenase | - |
OZX67_RS08930 (OZX67_08930) | 2386893..2388830 | + | 1938 | WP_277142725.1 | leucine-rich repeat domain-containing protein | - |
OZX67_RS08935 (OZX67_08935) | 2389374..2389625 | + | 252 | WP_277142728.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OZX67_RS08940 (OZX67_08940) | 2389618..2389905 | + | 288 | WP_277142730.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
OZX67_RS08945 (OZX67_08945) | 2389990..2392185 | + | 2196 | WP_277142732.1 | hypothetical protein | - |
OZX67_RS08950 (OZX67_08950) | 2392178..2393314 | + | 1137 | WP_277142734.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11211.16 Da Isoelectric Point: 10.0633
>T266168 WP_277142730.1 NZ_CP113925:2389618-2389905 [Bifidobacterium sp. ESL0728]
MLKHVTRTGTFLKDVKKLKRKHFNLDKLDYVIQLLIKQDTAILIHEYNDHALKGNLRTFRELHIEPDWLLVYQIEHGTLT
LVLVETGSHKQLLGR
MLKHVTRTGTFLKDVKKLKRKHFNLDKLDYVIQLLIKQDTAILIHEYNDHALKGNLRTFRELHIEPDWLLVYQIEHGTLT
LVLVETGSHKQLLGR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|