Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-DinJ |
Location | 637101..637656 | Replicon | chromosome |
Accession | NZ_CP113920 | ||
Organism | Bifidobacterium sp. ESL0732 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OZX70_RS02215 | Protein ID | WP_277181637.1 |
Coordinates | 637333..637656 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | OZX70_RS02210 | Protein ID | WP_277181636.1 |
Coordinates | 637101..637346 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZX70_RS02195 (OZX70_02195) | 632712..633335 | + | 624 | WP_277182074.1 | YigZ family protein | - |
OZX70_RS02200 (OZX70_02200) | 633357..634052 | + | 696 | WP_277181634.1 | AbrB family transcriptional regulator | - |
OZX70_RS02205 (OZX70_02205) | 635568..636521 | + | 954 | WP_277181635.1 | hypothetical protein | - |
OZX70_RS02210 (OZX70_02210) | 637101..637346 | + | 246 | WP_277181636.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OZX70_RS02215 (OZX70_02215) | 637333..637656 | + | 324 | WP_277181637.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OZX70_RS02220 (OZX70_02220) | 637869..638318 | + | 450 | WP_277143808.1 | 50S ribosomal protein L13 | - |
OZX70_RS02225 (OZX70_02225) | 638340..638831 | + | 492 | WP_277148890.1 | 30S ribosomal protein S9 | - |
OZX70_RS02230 (OZX70_02230) | 638999..639397 | + | 399 | WP_277182075.1 | VOC family protein | - |
OZX70_RS02235 (OZX70_02235) | 639875..642640 | + | 2766 | WP_277181638.1 | bifunctional acetaldehyde-CoA/alcohol dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11818.88 Da Isoelectric Point: 9.6541
>T266165 WP_277181637.1 NZ_CP113920:637333-637656 [Bifidobacterium sp. ESL0732]
VRRGEIWTVLTDGYASKPRPVIIIQNDEVPDFQSVVMCLLTSYDAGDIATRVRIEPSSGNGLNKVSFAMTDKILSVERKV
LGRKVGVLEGKTMRDIDKKLMVVLGLV
VRRGEIWTVLTDGYASKPRPVIIIQNDEVPDFQSVVMCLLTSYDAGDIATRVRIEPSSGNGLNKVSFAMTDKILSVERKV
LGRKVGVLEGKTMRDIDKKLMVVLGLV
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|