Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-dinJ/YafQ-DinJ |
| Location | 368611..369142 | Replicon | chromosome |
| Accession | NZ_CP113917 | ||
| Organism | Bifidobacterium sp. ESL0775 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OZX73_RS01095 | Protein ID | WP_277149844.1 |
| Coordinates | 368611..368910 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | - |
| Locus tag | OZX73_RS01100 | Protein ID | WP_277149846.1 |
| Coordinates | 368891..369142 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZX73_RS01085 (OZX73_01085) | 365106..367094 | - | 1989 | WP_277149841.1 | hypothetical protein | - |
| OZX73_RS01090 (OZX73_01090) | 367094..368527 | - | 1434 | WP_277149842.1 | hypothetical protein | - |
| OZX73_RS01095 (OZX73_01095) | 368611..368910 | - | 300 | WP_277149844.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| OZX73_RS01100 (OZX73_01100) | 368891..369142 | - | 252 | WP_277149846.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OZX73_RS01105 (OZX73_01105) | 369538..370608 | - | 1071 | WP_277149848.1 | 2,3-butanediol dehydrogenase | - |
| OZX73_RS01110 (OZX73_01110) | 370851..371870 | - | 1020 | WP_277150871.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
| OZX73_RS01115 (OZX73_01115) | 372366..373913 | - | 1548 | WP_277149850.1 | sucrose-6-phosphate hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11617.59 Da Isoelectric Point: 9.3865
>T266159 WP_277149844.1 NZ_CP113917:c368910-368611 [Bifidobacterium sp. ESL0775]
MSYGMLSHIKRTGTFLKDVKRLKRKHFDLDKLDYVIKLLMDQDTVTLIHQYDDHALKGNLHTLRELHIQPDWLLVYQIEH
GTLTLVLVETGSHKQLLGK
MSYGMLSHIKRTGTFLKDVKRLKRKHFDLDKLDYVIKLLMDQDTVTLIHQYDDHALKGNLHTLRELHIQPDWLLVYQIEH
GTLTLVLVETGSHKQLLGK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|