Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 1113498..1114031 | Replicon | chromosome |
| Accession | NZ_CP113916 | ||
| Organism | Lactobacillus sp. ESL0785 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OZY43_RS05290 | Protein ID | WP_277164038.1 |
| Coordinates | 1113759..1114031 (+) | Length | 91 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OZY43_RS05285 | Protein ID | WP_277164037.1 |
| Coordinates | 1113498..1113755 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZY43_RS05265 (OZY43_05265) | 1109981..1110127 | - | 147 | Protein_997 | D-2-hydroxyacid dehydrogenase | - |
| OZY43_RS05270 (OZY43_05270) | 1111044..1112093 | + | 1050 | WP_277164034.1 | restriction endonuclease subunit S | - |
| OZY43_RS05275 (OZY43_05275) | 1112256..1112417 | - | 162 | WP_277164035.1 | hypothetical protein | - |
| OZY43_RS05280 (OZY43_05280) | 1112434..1113354 | - | 921 | WP_277164036.1 | site-specific integrase | - |
| OZY43_RS05285 (OZY43_05285) | 1113498..1113755 | + | 258 | WP_277164037.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OZY43_RS05290 (OZY43_05290) | 1113759..1114031 | + | 273 | WP_277164038.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| OZY43_RS05295 (OZY43_05295) | 1114094..1115302 | - | 1209 | WP_277164039.1 | restriction endonuclease subunit S | - |
| OZY43_RS05300 (OZY43_05300) | 1115295..1116950 | - | 1656 | WP_277164040.1 | type I restriction-modification system subunit M | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10505.31 Da Isoelectric Point: 9.9839
>T266157 WP_277164038.1 NZ_CP113916:1113759-1114031 [Lactobacillus sp. ESL0785]
MLNIKVTAKFRKDVKRCNKQGLPMTQLKLVIHELEQNHVLPSNYKNHALDGTYSNYLECHIKPDWLLIYQITQTTLALIR
TGSHAELFKK
MLNIKVTAKFRKDVKRCNKQGLPMTQLKLVIHELEQNHVLPSNYKNHALDGTYSNYLECHIKPDWLLIYQITQTTLALIR
TGSHAELFKK
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|