Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-yefM/YoeB-RelB |
| Location | 5287739..5288280 | Replicon | chromosome |
| Accession | NZ_CP113910 | ||
| Organism | Streptomyces sp. KMM 9044 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | HUV60_RS23780 | Protein ID | WP_257849240.1 |
| Coordinates | 5287739..5288002 (-) | Length | 88 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | HUV60_RS23785 | Protein ID | WP_164493698.1 |
| Coordinates | 5287999..5288280 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HUV60_RS23750 (HUV60_023770) | 5283642..5283949 | + | 308 | Protein_4677 | CU044_5270 family protein | - |
| HUV60_RS23755 (HUV60_023775) | 5283987..5284814 | - | 828 | WP_269441231.1 | transposase family protein | - |
| HUV60_RS23760 (HUV60_023780) | 5285157..5285456 | + | 300 | WP_173313100.1 | hypothetical protein | - |
| HUV60_RS23765 (HUV60_023785) | 5285453..5285965 | + | 513 | WP_257849237.1 | hypothetical protein | - |
| HUV60_RS23770 (HUV60_023790) | 5286135..5286266 | - | 132 | WP_257849238.1 | hypothetical protein | - |
| HUV60_RS23775 (HUV60_023795) | 5286280..5286636 | - | 357 | WP_257849239.1 | DUF5911 domain-containing protein | - |
| HUV60_RS23780 (HUV60_023800) | 5287739..5288002 | - | 264 | WP_257849240.1 | Txe/YoeB family addiction module toxin | Toxin |
| HUV60_RS23785 (HUV60_023805) | 5287999..5288280 | - | 282 | WP_164493698.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| HUV60_RS23790 (HUV60_023810) | 5288628..5288780 | + | 153 | Protein_4685 | transposase | - |
| HUV60_RS23795 (HUV60_023815) | 5288841..5289782 | - | 942 | Protein_4686 | IS3 family transposase | - |
| HUV60_RS23800 (HUV60_023820) | 5290048..5290659 | - | 612 | WP_257849241.1 | ANTAR domain-containing protein | - |
| HUV60_RS23805 (HUV60_023825) | 5290937..5291974 | - | 1038 | WP_257849242.1 | rod shape-determining protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 5270028..5289782 | 19754 | |
| - | inside | Genomic island | - | - | 5278823..5289782 | 10959 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10446.81 Da Isoelectric Point: 8.0720
>T266151 WP_257849240.1 NZ_CP113910:c5288002-5287739 [Streptomyces sp. KMM 9044]
VKVLFVDDGWNDYLWWQGNDRKILKRINQLIADIDRGGHEGIGKPEPLRNDLSGYWSRRINSEHRLVYRIDENTIIHVVA
CRFHYER
VKVLFVDDGWNDYLWWQGNDRKILKRINQLIADIDRGGHEGIGKPEPLRNDLSGYWSRRINSEHRLVYRIDENTIIHVVA
CRFHYER
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|