Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 68429..69072 Replicon plasmid pPSKoxy4_3
Accession NZ_CP113907
Organism Klebsiella michiganensis strain PS_Koxy4

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag F0A14_RS30585 Protein ID WP_000754566.1
Coordinates 68429..68845 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag F0A14_RS30590 Protein ID WP_001261276.1
Coordinates 68842..69072 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
F0A14_RS30555 (F0A14_030550) 63682..63957 - 276 WP_000732275.1 mercury resistance system periplasmic binding protein MerP -
F0A14_RS30560 (F0A14_030555) 63973..64368 - 396 WP_001294653.1 mercuric ion transporter MerT -
F0A14_RS30565 (F0A14_030560) 64440..64895 + 456 WP_001166628.1 Hg(II)-responsive transcriptional regulator -
F0A14_RS30570 (F0A14_030565) 64928..65278 - 351 Protein_70 IS3 family transposase -
F0A14_RS30575 (F0A14_030570) 65359..66867 - 1509 WP_001189111.1 group II intron reverse transcriptase/maturase -
F0A14_RS30580 (F0A14_030575) 67540..68225 - 686 Protein_72 IS3 family transposase -
F0A14_RS30585 (F0A14_030580) 68429..68845 - 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
F0A14_RS30590 (F0A14_030585) 68842..69072 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
F0A14_RS30595 (F0A14_030590) 69029..69283 + 255 Protein_75 hypothetical protein -
F0A14_RS30600 (F0A14_030595) 69390..69569 + 180 WP_004118349.1 type II toxin-antitoxin system ParD family antitoxin -
F0A14_RS30605 (F0A14_030600) 69556..69654 + 99 WP_004118348.1 type II toxin-antitoxin system RelE/ParE family toxin -
F0A14_RS30610 (F0A14_030605) 69691..69853 + 163 Protein_78 type II toxin-antitoxin system RelE/ParE family toxin -
F0A14_RS30615 (F0A14_030610) 70032..70466 - 435 WP_004118347.1 hypothetical protein -
F0A14_RS30620 (F0A14_030615) 70682..72082 - 1401 WP_004118346.1 copper resistance membrane spanning protein PcoS -
F0A14_RS30625 (F0A14_030620) 72079..72759 - 681 WP_001188930.1 copper response regulator transcription factor PcoR -
F0A14_RS30630 (F0A14_030625) 72814..73743 - 930 WP_004118344.1 copper resistance inner membrane protein PcoD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..76870 76870


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T266150 WP_000754566.1 NZ_CP113907:c68845-68429 [Klebsiella michiganensis]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT266150 WP_001261276.1 NZ_CP113907:c69072-68842 [Klebsiella michiganensis]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References