Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 68429..69072 | Replicon | plasmid pPSKoxy4_3 |
| Accession | NZ_CP113907 | ||
| Organism | Klebsiella michiganensis strain PS_Koxy4 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q84A06 |
| Locus tag | F0A14_RS30585 | Protein ID | WP_000754566.1 |
| Coordinates | 68429..68845 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | F0A14_RS30590 | Protein ID | WP_001261276.1 |
| Coordinates | 68842..69072 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F0A14_RS30555 (F0A14_030550) | 63682..63957 | - | 276 | WP_000732275.1 | mercury resistance system periplasmic binding protein MerP | - |
| F0A14_RS30560 (F0A14_030555) | 63973..64368 | - | 396 | WP_001294653.1 | mercuric ion transporter MerT | - |
| F0A14_RS30565 (F0A14_030560) | 64440..64895 | + | 456 | WP_001166628.1 | Hg(II)-responsive transcriptional regulator | - |
| F0A14_RS30570 (F0A14_030565) | 64928..65278 | - | 351 | Protein_70 | IS3 family transposase | - |
| F0A14_RS30575 (F0A14_030570) | 65359..66867 | - | 1509 | WP_001189111.1 | group II intron reverse transcriptase/maturase | - |
| F0A14_RS30580 (F0A14_030575) | 67540..68225 | - | 686 | Protein_72 | IS3 family transposase | - |
| F0A14_RS30585 (F0A14_030580) | 68429..68845 | - | 417 | WP_000754566.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| F0A14_RS30590 (F0A14_030585) | 68842..69072 | - | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| F0A14_RS30595 (F0A14_030590) | 69029..69283 | + | 255 | Protein_75 | hypothetical protein | - |
| F0A14_RS30600 (F0A14_030595) | 69390..69569 | + | 180 | WP_004118349.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| F0A14_RS30605 (F0A14_030600) | 69556..69654 | + | 99 | WP_004118348.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| F0A14_RS30610 (F0A14_030605) | 69691..69853 | + | 163 | Protein_78 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| F0A14_RS30615 (F0A14_030610) | 70032..70466 | - | 435 | WP_004118347.1 | hypothetical protein | - |
| F0A14_RS30620 (F0A14_030615) | 70682..72082 | - | 1401 | WP_004118346.1 | copper resistance membrane spanning protein PcoS | - |
| F0A14_RS30625 (F0A14_030620) | 72079..72759 | - | 681 | WP_001188930.1 | copper response regulator transcription factor PcoR | - |
| F0A14_RS30630 (F0A14_030625) | 72814..73743 | - | 930 | WP_004118344.1 | copper resistance inner membrane protein PcoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..76870 | 76870 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15006.52 Da Isoelectric Point: 9.2957
>T266150 WP_000754566.1 NZ_CP113907:c68845-68429 [Klebsiella michiganensis]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K1G3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |