266148

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 58976..59501 Replicon plasmid pPSKoxy4_1
Accession NZ_CP113905
Organism Klebsiella michiganensis strain PS_Koxy4

Toxin (Protein)


Gene name ccdB Uniprot ID J5VBT8
Locus tag F0A14_RS29120 Protein ID WP_004197633.1
Coordinates 59196..59501 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A9E1GDP8
Locus tag F0A14_RS29115 Protein ID WP_004197642.1
Coordinates 58976..59194 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
F0A14_RS29070 (F0A14_029065) 54082..55077 + 996 WP_019725651.1 hypothetical protein -
F0A14_RS29075 (F0A14_029070) 55150..55473 + 324 WP_019725650.1 hypothetical protein -
F0A14_RS29080 (F0A14_029075) 55907..56101 + 195 WP_019725033.1 hypothetical protein -
F0A14_RS29085 (F0A14_029080) 56145..56375 - 231 WP_019725034.1 hypothetical protein -
F0A14_RS29090 (F0A14_029085) 56389..56592 - 204 WP_019725040.1 HHA domain-containing protein -
F0A14_RS29095 (F0A14_029090) 56626..56994 - 369 WP_015065502.1 hypothetical protein -
F0A14_RS29100 (F0A14_029095) 57038..57532 - 495 WP_009310053.1 hypothetical protein -
F0A14_RS29105 (F0A14_029100) 57563..58135 - 573 WP_015065504.1 hypothetical protein -
F0A14_RS29110 (F0A14_029105) 58132..58380 - 249 WP_019725036.1 hypothetical protein -
F0A14_RS29115 (F0A14_029110) 58976..59194 + 219 WP_004197642.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
F0A14_RS29120 (F0A14_029115) 59196..59501 + 306 WP_004197633.1 type II toxin-antitoxin system toxin CcdB Toxin
F0A14_RS29125 (F0A14_029120) 59670..60071 + 402 WP_072199347.1 hypothetical protein -
F0A14_RS29130 (F0A14_029125) 60098..60421 + 324 WP_004197641.1 hypothetical protein -
F0A14_RS29135 (F0A14_029130) 60418..61434 + 1017 WP_004197639.1 hypothetical protein -
F0A14_RS29140 (F0A14_029135) 61632..62426 + 795 WP_004197635.1 site-specific integrase -
F0A14_RS29145 (F0A14_029140) 62858..63160 - 303 WP_004197636.1 hypothetical protein -
F0A14_RS29150 (F0A14_029145) 63157..63783 - 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid qnrB1 / aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa / dfrA14 / blaCTX-M-15 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 - 1..130876 130876


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11585.27 Da        Isoelectric Point: 6.4661

>T266148 WP_004197633.1 NZ_CP113905:59196-59501 [Klebsiella michiganensis]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8376.34 Da        Isoelectric Point: 4.7405

>AT266148 WP_004197642.1 NZ_CP113905:58976-59194 [Klebsiella michiganensis]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2A5MCG5

Antitoxin

Source ID Structure

References