Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 58976..59501 | Replicon | plasmid pPSKoxy4_1 |
| Accession | NZ_CP113905 | ||
| Organism | Klebsiella michiganensis strain PS_Koxy4 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | J5VBT8 |
| Locus tag | F0A14_RS29120 | Protein ID | WP_004197633.1 |
| Coordinates | 59196..59501 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A9E1GDP8 |
| Locus tag | F0A14_RS29115 | Protein ID | WP_004197642.1 |
| Coordinates | 58976..59194 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F0A14_RS29070 (F0A14_029065) | 54082..55077 | + | 996 | WP_019725651.1 | hypothetical protein | - |
| F0A14_RS29075 (F0A14_029070) | 55150..55473 | + | 324 | WP_019725650.1 | hypothetical protein | - |
| F0A14_RS29080 (F0A14_029075) | 55907..56101 | + | 195 | WP_019725033.1 | hypothetical protein | - |
| F0A14_RS29085 (F0A14_029080) | 56145..56375 | - | 231 | WP_019725034.1 | hypothetical protein | - |
| F0A14_RS29090 (F0A14_029085) | 56389..56592 | - | 204 | WP_019725040.1 | HHA domain-containing protein | - |
| F0A14_RS29095 (F0A14_029090) | 56626..56994 | - | 369 | WP_015065502.1 | hypothetical protein | - |
| F0A14_RS29100 (F0A14_029095) | 57038..57532 | - | 495 | WP_009310053.1 | hypothetical protein | - |
| F0A14_RS29105 (F0A14_029100) | 57563..58135 | - | 573 | WP_015065504.1 | hypothetical protein | - |
| F0A14_RS29110 (F0A14_029105) | 58132..58380 | - | 249 | WP_019725036.1 | hypothetical protein | - |
| F0A14_RS29115 (F0A14_029110) | 58976..59194 | + | 219 | WP_004197642.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| F0A14_RS29120 (F0A14_029115) | 59196..59501 | + | 306 | WP_004197633.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| F0A14_RS29125 (F0A14_029120) | 59670..60071 | + | 402 | WP_072199347.1 | hypothetical protein | - |
| F0A14_RS29130 (F0A14_029125) | 60098..60421 | + | 324 | WP_004197641.1 | hypothetical protein | - |
| F0A14_RS29135 (F0A14_029130) | 60418..61434 | + | 1017 | WP_004197639.1 | hypothetical protein | - |
| F0A14_RS29140 (F0A14_029135) | 61632..62426 | + | 795 | WP_004197635.1 | site-specific integrase | - |
| F0A14_RS29145 (F0A14_029140) | 62858..63160 | - | 303 | WP_004197636.1 | hypothetical protein | - |
| F0A14_RS29150 (F0A14_029145) | 63157..63783 | - | 627 | WP_004197649.1 | ParA family plasmid-partitioning AAA ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qnrB1 / aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa / dfrA14 / blaCTX-M-15 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..130876 | 130876 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11585.27 Da Isoelectric Point: 6.4661
>T266148 WP_004197633.1 NZ_CP113905:59196-59501 [Klebsiella michiganensis]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|