Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 5467552..5468078 | Replicon | chromosome |
Accession | NZ_CP113904 | ||
Organism | Klebsiella michiganensis strain PS_Koxy4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A7R6HXL1 |
Locus tag | F0A14_RS25835 | Protein ID | WP_015572079.1 |
Coordinates | 5467791..5468078 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | F0A14_RS25830 | Protein ID | WP_000534858.1 |
Coordinates | 5467552..5467791 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F0A14_RS25810 (F0A14_025810) | 5463021..5463836 | - | 816 | WP_004118130.1 | SDR family oxidoreductase | - |
F0A14_RS25815 (F0A14_025815) | 5464228..5465955 | + | 1728 | WP_182094697.1 | ATP-binding protein | - |
F0A14_RS25820 (F0A14_025820) | 5465952..5467367 | + | 1416 | WP_182094696.1 | AAA family ATPase | - |
F0A14_RS25825 (F0A14_025825) | 5467416..5467527 | - | 112 | Protein_5076 | hypothetical protein | - |
F0A14_RS25830 (F0A14_025830) | 5467552..5467791 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
F0A14_RS25835 (F0A14_025835) | 5467791..5468078 | + | 288 | WP_015572079.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
F0A14_RS25840 (F0A14_025840) | 5468195..5468722 | + | 528 | WP_259347316.1 | hypothetical protein | - |
F0A14_RS25845 (F0A14_025845) | 5469223..5469600 | - | 378 | WP_182094695.1 | acetyltransferase | - |
F0A14_RS25850 (F0A14_025850) | 5469597..5472455 | - | 2859 | WP_182094694.1 | conjugative transfer ATPase | - |
F0A14_RS25855 (F0A14_025855) | 5472455..5472865 | - | 411 | WP_006785978.1 | TIGR03751 family conjugal transfer lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5409845..5498435 | 88590 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11209.09 Da Isoelectric Point: 10.0714
>T266147 WP_015572079.1 NZ_CP113904:5467791-5468078 [Klebsiella michiganensis]
MAYFLDFDERALKEWRKLGSTVREQLKNKLAEVLESPRIDANKLRGMHDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKNKLAEVLESPRIDANKLRGMHDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|