Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 5170788..5171364 | Replicon | chromosome |
Accession | NZ_CP113904 | ||
Organism | Klebsiella michiganensis strain PS_Koxy4 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A443WNM0 |
Locus tag | F0A14_RS24415 | Protein ID | WP_064380994.1 |
Coordinates | 5171077..5171364 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A0H3H591 |
Locus tag | F0A14_RS24410 | Protein ID | WP_014227757.1 |
Coordinates | 5170788..5171090 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F0A14_RS24395 (F0A14_024395) | 5167627..5167962 | + | 336 | WP_014227760.1 | endoribonuclease SymE | - |
F0A14_RS24400 (F0A14_024400) | 5168416..5169327 | + | 912 | WP_182094964.1 | acetamidase/formamidase family protein | - |
F0A14_RS24405 (F0A14_024405) | 5169324..5170667 | + | 1344 | WP_004128506.1 | APC family permease | - |
F0A14_RS24410 (F0A14_024410) | 5170788..5171090 | - | 303 | WP_014227757.1 | BrnA antitoxin family protein | Antitoxin |
F0A14_RS24415 (F0A14_024415) | 5171077..5171364 | - | 288 | WP_064380994.1 | BrnT family toxin | Toxin |
F0A14_RS24420 (F0A14_024420) | 5171624..5172067 | - | 444 | WP_014227755.1 | FosA family fosfomycin resistance glutathione transferase | - |
F0A14_RS24425 (F0A14_024425) | 5172061..5172969 | - | 909 | WP_049080873.1 | LysR family transcriptional regulator | - |
F0A14_RS24430 (F0A14_024430) | 5173057..5173839 | + | 783 | WP_025108473.1 | NAD(P)H-dependent oxidoreductase | - |
F0A14_RS24435 (F0A14_024435) | 5173987..5174571 | + | 585 | WP_004098242.1 | TetR/AcrR family transcriptional regulator | - |
F0A14_RS24440 (F0A14_024440) | 5174589..5175389 | + | 801 | WP_182094965.1 | winged helix-turn-helix domain-containing protein | - |
F0A14_RS24445 (F0A14_024445) | 5175386..5175904 | + | 519 | WP_004098240.1 | FidL-like protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11162.65 Da Isoelectric Point: 7.4687
>T266146 WP_064380994.1 NZ_CP113904:c5171364-5171077 [Klebsiella michiganensis]
MPMEFEWDANKAISNLRKHGIRFEEAVLVLDDPRHLSRQDRYENGEYRWQTIGLVHGVIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
MPMEFEWDANKAISNLRKHGIRFEEAVLVLDDPRHLSRQDRYENGEYRWQTIGLVHGVIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A443WNM0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3H591 |