Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4495737..4496356 | Replicon | chromosome |
| Accession | NZ_CP113904 | ||
| Organism | Klebsiella michiganensis strain PS_Koxy4 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H3N9D8 |
| Locus tag | F0A14_RS21305 | Protein ID | WP_004099646.1 |
| Coordinates | 4496138..4496356 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A0J2I7Z1 |
| Locus tag | F0A14_RS21300 | Protein ID | WP_025107145.1 |
| Coordinates | 4495737..4496111 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F0A14_RS21290 (F0A14_021290) | 4490893..4492086 | + | 1194 | WP_004136054.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| F0A14_RS21295 (F0A14_021295) | 4492109..4495255 | + | 3147 | WP_032748290.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| F0A14_RS21300 (F0A14_021300) | 4495737..4496111 | + | 375 | WP_025107145.1 | Hha toxicity modulator TomB | Antitoxin |
| F0A14_RS21305 (F0A14_021305) | 4496138..4496356 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
| F0A14_RS21310 (F0A14_021310) | 4496519..4497085 | + | 567 | WP_032748289.1 | maltose O-acetyltransferase | - |
| F0A14_RS21315 (F0A14_021315) | 4497057..4497191 | - | 135 | WP_223226764.1 | hypothetical protein | - |
| F0A14_RS21320 (F0A14_021320) | 4497212..4497682 | + | 471 | WP_014228205.1 | YlaC family protein | - |
| F0A14_RS21325 (F0A14_021325) | 4497657..4499111 | - | 1455 | WP_182094349.1 | PLP-dependent aminotransferase family protein | - |
| F0A14_RS21330 (F0A14_021330) | 4499213..4499911 | + | 699 | WP_048261453.1 | GNAT family protein | - |
| F0A14_RS21335 (F0A14_021335) | 4499908..4500048 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| F0A14_RS21340 (F0A14_021340) | 4500048..4500311 | - | 264 | WP_004848323.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T266144 WP_004099646.1 NZ_CP113904:4496138-4496356 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14366.15 Da Isoelectric Point: 4.8989
>AT266144 WP_025107145.1 NZ_CP113904:4495737-4496111 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H713 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2I7Z1 |