Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4495737..4496356 Replicon chromosome
Accession NZ_CP113904
Organism Klebsiella michiganensis strain PS_Koxy4

Toxin (Protein)


Gene name Hha Uniprot ID H3N9D8
Locus tag F0A14_RS21305 Protein ID WP_004099646.1
Coordinates 4496138..4496356 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A0J2I7Z1
Locus tag F0A14_RS21300 Protein ID WP_025107145.1
Coordinates 4495737..4496111 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
F0A14_RS21290 (F0A14_021290) 4490893..4492086 + 1194 WP_004136054.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
F0A14_RS21295 (F0A14_021295) 4492109..4495255 + 3147 WP_032748290.1 multidrug efflux RND transporter permease subunit AcrB -
F0A14_RS21300 (F0A14_021300) 4495737..4496111 + 375 WP_025107145.1 Hha toxicity modulator TomB Antitoxin
F0A14_RS21305 (F0A14_021305) 4496138..4496356 + 219 WP_004099646.1 HHA domain-containing protein Toxin
F0A14_RS21310 (F0A14_021310) 4496519..4497085 + 567 WP_032748289.1 maltose O-acetyltransferase -
F0A14_RS21315 (F0A14_021315) 4497057..4497191 - 135 WP_223226764.1 hypothetical protein -
F0A14_RS21320 (F0A14_021320) 4497212..4497682 + 471 WP_014228205.1 YlaC family protein -
F0A14_RS21325 (F0A14_021325) 4497657..4499111 - 1455 WP_182094349.1 PLP-dependent aminotransferase family protein -
F0A14_RS21330 (F0A14_021330) 4499213..4499911 + 699 WP_048261453.1 GNAT family protein -
F0A14_RS21335 (F0A14_021335) 4499908..4500048 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
F0A14_RS21340 (F0A14_021340) 4500048..4500311 - 264 WP_004848323.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-115)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T266144 WP_004099646.1 NZ_CP113904:4496138-4496356 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14366.15 Da        Isoelectric Point: 4.8989

>AT266144 WP_025107145.1 NZ_CP113904:4495737-4496111 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3H713

Antitoxin

Source ID Structure
AlphaFold DB A0A0J2I7Z1

References