Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 876239..876896 | Replicon | chromosome |
Accession | NZ_CP113904 | ||
Organism | Klebsiella michiganensis strain PS_Koxy4 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | J5U333 |
Locus tag | F0A14_RS04225 | Protein ID | WP_004854060.1 |
Coordinates | 876486..876896 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | H3N295 |
Locus tag | F0A14_RS04220 | Protein ID | WP_004124953.1 |
Coordinates | 876239..876505 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F0A14_RS04205 (F0A14_004210) | 871473..871898 | - | 426 | WP_004854067.1 | PTS sugar transporter subunit IIA | - |
F0A14_RS04210 (F0A14_004215) | 872019..874817 | - | 2799 | WP_049079129.1 | transcriptional regulator DagR | - |
F0A14_RS04215 (F0A14_004220) | 875011..875994 | - | 984 | WP_014226793.1 | tRNA-modifying protein YgfZ | - |
F0A14_RS04220 (F0A14_004225) | 876239..876505 | + | 267 | WP_004124953.1 | FAD assembly factor SdhE | Antitoxin |
F0A14_RS04225 (F0A14_004230) | 876486..876896 | + | 411 | WP_004854060.1 | protein YgfX | Toxin |
F0A14_RS04230 (F0A14_004235) | 876905..877426 | - | 522 | WP_143440241.1 | flavodoxin FldB | - |
F0A14_RS04235 (F0A14_004240) | 877548..878444 | + | 897 | WP_004105555.1 | site-specific tyrosine recombinase XerD | - |
F0A14_RS04240 (F0A14_004245) | 878467..879180 | + | 714 | WP_004854054.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
F0A14_RS04245 (F0A14_004250) | 879186..880919 | + | 1734 | WP_182095148.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16106.97 Da Isoelectric Point: 10.9455
>T266139 WP_004854060.1 NZ_CP113904:876486-876896 [Klebsiella michiganensis]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYA5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3H3L9 |