Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 777875..778653 | Replicon | chromosome |
Accession | NZ_CP113904 | ||
Organism | Klebsiella michiganensis strain PS_Koxy4 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | F0A14_RS03730 | Protein ID | WP_182094790.1 |
Coordinates | 778165..778653 (+) | Length | 163 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A2J5Q8I3 |
Locus tag | F0A14_RS03725 | Protein ID | WP_049101739.1 |
Coordinates | 777875..778168 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F0A14_RS03705 (F0A14_003710) | 773031..774176 | - | 1146 | WP_085520127.1 | PLP-dependent aspartate aminotransferase family protein | - |
F0A14_RS03710 (F0A14_003715) | 774187..775557 | - | 1371 | WP_025105933.1 | cystathionine beta-synthase | - |
F0A14_RS03715 (F0A14_003720) | 775591..775833 | + | 243 | WP_014226848.1 | hypothetical protein | - |
F0A14_RS03720 (F0A14_003725) | 776103..777491 | + | 1389 | WP_048260433.1 | DASS family sodium-coupled anion symporter | - |
F0A14_RS03725 (F0A14_003730) | 777875..778168 | + | 294 | WP_049101739.1 | DUF1778 domain-containing protein | Antitoxin |
F0A14_RS03730 (F0A14_003735) | 778165..778653 | + | 489 | WP_182094790.1 | GNAT family N-acetyltransferase | Toxin |
F0A14_RS03735 (F0A14_003740) | 778718..779416 | + | 699 | WP_032692862.1 | hypothetical protein | - |
F0A14_RS03740 (F0A14_003745) | 779523..781223 | - | 1701 | WP_032692861.1 | hypothetical protein | - |
F0A14_RS03745 (F0A14_003750) | 781220..783130 | - | 1911 | WP_182094789.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 163 a.a. Molecular weight: 17731.67 Da Isoelectric Point: 7.7536
>T266138 WP_182094790.1 NZ_CP113904:778165-778653 [Klebsiella michiganensis]
MISTPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQLSGASRTFVCCHDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDRSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYLRVGFEPSPMDPMMFMVTLGDLVE
SI
MISTPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQLSGASRTFVCCHDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDRSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYLRVGFEPSPMDPMMFMVTLGDLVE
SI
Download Length: 489 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|