Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 56829..57376 | Replicon | chromosome |
| Accession | NZ_CP113904 | ||
| Organism | Klebsiella michiganensis strain PS_Koxy4 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | A0A0H3H5T3 |
| Locus tag | F0A14_RS00285 | Protein ID | WP_014227299.1 |
| Coordinates | 56829..57137 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A0H3H0P7 |
| Locus tag | F0A14_RS00290 | Protein ID | WP_014227298.1 |
| Coordinates | 57140..57376 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F0A14_RS00260 (F0A14_000260) | 52745..53056 | - | 312 | WP_014227304.1 | PTS sugar transporter subunit IIB | - |
| F0A14_RS00265 (F0A14_000265) | 53351..54292 | + | 942 | WP_014227303.1 | LacI family DNA-binding transcriptional regulator | - |
| F0A14_RS00270 (F0A14_000270) | 54316..54609 | - | 294 | WP_014227302.1 | YicS family protein | - |
| F0A14_RS00275 (F0A14_000275) | 54819..55772 | + | 954 | WP_032751828.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| F0A14_RS00280 (F0A14_000280) | 55776..56678 | - | 903 | WP_014227300.1 | EamA family transporter | - |
| F0A14_RS00285 (F0A14_000285) | 56829..57137 | - | 309 | WP_014227299.1 | CcdB family protein | Toxin |
| F0A14_RS00290 (F0A14_000290) | 57140..57376 | - | 237 | WP_014227298.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| F0A14_RS00295 (F0A14_000295) | 57482..58915 | - | 1434 | WP_014839829.1 | PTS N-acetylmuramic acid transporter subunit IIBC | - |
| F0A14_RS00300 (F0A14_000300) | 58940..59842 | - | 903 | WP_009654080.1 | N-acetylmuramic acid 6-phosphate etherase | - |
| F0A14_RS00305 (F0A14_000305) | 60003..61169 | - | 1167 | WP_085520169.1 | multidrug effflux MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11725.57 Da Isoelectric Point: 7.2729
>T266137 WP_014227299.1 NZ_CP113904:c57137-56829 [Klebsiella michiganensis]
MQYYVYKNTGRIAAYPYLLDVQSDIIGKRNTRVVIPLFPLKNYKGPRADRLTPLVTVEGEEYVVMTHELASIPHRVLGEE
VCNLNHQREVVKASMDFLFDGI
MQYYVYKNTGRIAAYPYLLDVQSDIIGKRNTRVVIPLFPLKNYKGPRADRLTPLVTVEGEEYVVMTHELASIPHRVLGEE
VCNLNHQREVVKASMDFLFDGI
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H5T3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H0P7 |