Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-Phd
Location 4430422..4430947 Replicon chromosome
Accession NZ_CP113837
Organism Kitasatospora sp. YST-16

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OU787_RS20400 Protein ID WP_268660234.1
Coordinates 4430422..4430685 (-) Length 88 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID D9VWZ5
Locus tag OU787_RS20405 Protein ID WP_007266282.1
Coordinates 4430678..4430947 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OU787_RS20365 (OU787_20365) 4425694..4426668 + 975 WP_030463742.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
OU787_RS20370 (OU787_20370) 4426824..4427600 + 777 WP_051817918.1 ROK family protein -
OU787_RS20375 (OU787_20375) 4427611..4427967 - 357 WP_268660232.1 hypothetical protein -
OU787_RS20380 (OU787_20380) 4427973..4428191 - 219 WP_268660233.1 hypothetical protein -
OU787_RS20385 (OU787_20385) 4428372..4429445 + 1074 WP_030463745.1 redox-regulated ATPase YchF -
OU787_RS20390 (OU787_20390) 4429644..4429925 + 282 WP_030463746.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
OU787_RS20395 (OU787_20395) 4429922..4430176 + 255 WP_030463747.1 Txe/YoeB family addiction module toxin -
OU787_RS20400 (OU787_20400) 4430422..4430685 - 264 WP_268660234.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OU787_RS20405 (OU787_20405) 4430678..4430947 - 270 WP_007266282.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OU787_RS20410 (OU787_20410) 4431188..4431877 + 690 WP_268660235.1 2-phosphosulfolactate phosphatase -
OU787_RS20415 (OU787_20415) 4431954..4432541 + 588 WP_268660236.1 TetR/AcrR family transcriptional regulator -
OU787_RS20420 (OU787_20420) 4432538..4433947 + 1410 WP_268660237.1 MFS transporter -
OU787_RS20425 (OU787_20425) 4433960..4434337 + 378 WP_268660238.1 VOC family protein -
OU787_RS20430 (OU787_20430) 4434430..4435161 + 732 WP_268660239.1 alpha/beta hydrolase -
OU787_RS20435 (OU787_20435) 4435249..4435905 - 657 WP_030463753.1 HAD-IA family hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4421579..4430947 9368


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(9-58)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10049.49 Da        Isoelectric Point: 7.3168

>T266135 WP_268660234.1 NZ_CP113837:c4430685-4430422 [Kitasatospora sp. YST-16]
VSEYRTVFHPEAQAELRKIPRDMALRILAKLAELETDPLGFNTTALVSQPERRRLRVGDYRVVYTIDNGELVVWVVHVGH
RSTVYET

Download         Length: 264 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10289.74 Da        Isoelectric Point: 4.6265

>AT266135 WP_007266282.1 NZ_CP113837:c4430947-4430678 [Kitasatospora sp. YST-16]
MTQPLPIESIRDVRAHLAEVVERADRDDVPTVITRRGKEVAAVVSIEVLRKYQEWEEREINRIIDERMANPAPGIPIEDI
MRETLARSE

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB D9VWZ5

References