Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 21424..22043 | Replicon | plasmid pEFM61-2 |
Accession | NZ_CP113834 | ||
Organism | Enterococcus faecalis strain M61 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | R3H4V2 |
Locus tag | OZF29_RS13990 | Protein ID | WP_000241511.1 |
Coordinates | 21424..21786 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3H5D1 |
Locus tag | OZF29_RS13995 | Protein ID | WP_000245205.1 |
Coordinates | 21780..22043 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZF29_RS13975 (16834) | 16834..18765 | - | 1932 | WP_010816308.1 | sucrose-specific PTS transporter subunit IIBC | - |
OZF29_RS13980 (18956) | 18956..20395 | + | 1440 | WP_002367771.1 | sucrose-6-phosphate hydrolase | - |
OZF29_RS13985 (20397) | 20397..21359 | + | 963 | WP_002367770.1 | LacI family DNA-binding transcriptional regulator | - |
OZF29_RS13990 (21424) | 21424..21786 | - | 363 | WP_000241511.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OZF29_RS13995 (21780) | 21780..22043 | - | 264 | WP_000245205.1 | PbsX family transcriptional regulator | Antitoxin |
OZF29_RS14000 (22541) | 22541..23191 | - | 651 | WP_251846817.1 | transposase | - |
OZF29_RS14005 (24442) | 24442..25083 | - | 642 | WP_000406546.1 | hypothetical protein | - |
OZF29_RS14010 (25465) | 25465..26778 | - | 1314 | WP_002383787.1 | hypothetical protein | - |
OZF29_RS14015 (26768) | 26768..26899 | - | 132 | WP_000159353.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | prgB/asc10 | 1..68512 | 68512 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13585.78 Da Isoelectric Point: 9.6107
>T266131 WP_000241511.1 NZ_CP113834:c21786-21424 [Enterococcus faecalis]
MVKVPHQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVIVAPISSTKRNYPLYVSINPSYGMKTSGKVLLDQLT
TIDYEARQCVFLETAHEKLIDELLLKVRTVFQKVNKTNKF
MVKVPHQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVIVAPISSTKRNYPLYVSINPSYGMKTSGKVLLDQLT
TIDYEARQCVFLETAHEKLIDELLLKVRTVFQKVNKTNKF
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|