Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 3103..3674 | Replicon | plasmid pEFM61-2 |
| Accession | NZ_CP113834 | ||
| Organism | Enterococcus faecalis strain M61 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2P6BPI5 |
| Locus tag | OZF29_RS13910 | Protein ID | WP_002394791.1 |
| Coordinates | 3333..3674 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | OZF29_RS13905 | Protein ID | WP_002362431.1 |
| Coordinates | 3103..3333 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZF29_RS13875 (191) | 191..508 | + | 318 | WP_002394802.1 | heavy metal-binding domain-containing protein | - |
| OZF29_RS13880 (544) | 544..1212 | + | 669 | WP_002403283.1 | CPBP family intramembrane metalloprotease | - |
| OZF29_RS13885 (1329) | 1329..1583 | + | 255 | WP_002394800.1 | hypothetical protein | - |
| OZF29_RS13890 (1743) | 1743..1976 | - | 234 | WP_002394799.1 | hypothetical protein | - |
| OZF29_RS13895 (1978) | 1978..2289 | - | 312 | WP_251846816.1 | hypothetical protein | - |
| OZF29_RS13900 (2279) | 2279..2899 | - | 621 | WP_002367784.1 | recombinase family protein | - |
| OZF29_RS13905 (3103) | 3103..3333 | + | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| OZF29_RS13910 (3333) | 3333..3674 | + | 342 | WP_002394791.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OZF29_RS13915 (3786) | 3786..4724 | + | 939 | WP_002394789.1 | hypothetical protein | - |
| OZF29_RS13920 (4992) | 4992..5594 | + | 603 | WP_002367780.1 | Fic family protein | - |
| OZF29_RS13925 (5828) | 5828..6508 | - | 681 | WP_104680861.1 | IS6 family transposase | - |
| OZF29_RS13930 (6763) | 6763..7701 | + | 939 | WP_116495287.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | prgB/asc10 | 1..68512 | 68512 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13248.49 Da Isoelectric Point: 8.8595
>T266130 WP_002394791.1 NZ_CP113834:3333-3674 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P6BPI5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R3KHK9 |