Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 65353..65924 Replicon plasmid pEFM61-1
Accession NZ_CP113833
Organism Enterococcus faecalis strain M61

Toxin (Protein)


Gene name mazF Uniprot ID A0A2P6BPI5
Locus tag OZF29_RS13790 Protein ID WP_002394791.1
Coordinates 65353..65694 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag OZF29_RS13795 Protein ID WP_002362431.1
Coordinates 65694..65924 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OZF29_RS13770 (OZF29_13770) 61797..62279 + 483 WP_010817773.1 PTS glucose transporter subunit IIA -
OZF29_RS13775 (OZF29_13775) 62519..63199 + 681 WP_071621256.1 IS6 family transposase -
OZF29_RS13780 (OZF29_13780) 63433..64035 - 603 WP_002367780.1 Fic family protein -
OZF29_RS13785 (OZF29_13785) 64303..65241 - 939 WP_002394789.1 hypothetical protein -
OZF29_RS13790 (OZF29_13790) 65353..65694 - 342 WP_002394791.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
OZF29_RS13795 (OZF29_13795) 65694..65924 - 231 WP_002362431.1 hypothetical protein Antitoxin
OZF29_RS13800 (OZF29_13800) 66128..66748 + 621 WP_002375379.1 recombinase family protein -
OZF29_RS13805 (OZF29_13805) 66765..67052 + 288 WP_085406799.1 hypothetical protein -
OZF29_RS13810 (OZF29_13810) 67046..67291 + 246 WP_116495280.1 ultraviolet resistance protein UvrA repressor UvrC -
OZF29_RS13815 (OZF29_13815) 67331..67540 + 210 WP_002363054.1 hypothetical protein -
OZF29_RS13820 (OZF29_13820) 67554..67712 + 159 Protein_78 recombinase family protein -
OZF29_RS13825 (OZF29_13825) 67881..68132 + 252 WP_010815874.1 hypothetical protein -
OZF29_RS13830 (OZF29_13830) 68187..68624 - 438 WP_116495281.1 hypothetical protein -
OZF29_RS13835 (OZF29_13835) 68716..68967 + 252 WP_010815876.1 hypothetical protein -
OZF29_RS13840 (OZF29_13840) 69083..70399 + 1317 WP_116495282.1 Y-family DNA polymerase -
OZF29_RS13845 (OZF29_13845) 70403..70918 + 516 WP_002394804.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid cat / tet(L) / tet(M) / erm(B) / aph(3')-III / dfrG bsh 1..73413 73413
- flank IS/Tn - - 62741..63199 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13248.49 Da        Isoelectric Point: 8.8595

>T266129 WP_002394791.1 NZ_CP113833:c65694-65353 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT266129 WP_002362431.1 NZ_CP113833:c65924-65694 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P6BPI5

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References