Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 22858..23995 | Replicon | plasmid pEFM61-1 |
| Accession | NZ_CP113833 | ||
| Organism | Enterococcus faecalis strain M61 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | P0A4M2 |
| Locus tag | OZF29_RS13560 | Protein ID | WP_002332783.1 |
| Coordinates | 23132..23995 (+) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL19 |
| Locus tag | OZF29_RS13555 | Protein ID | WP_002326825.1 |
| Coordinates | 22858..23130 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZF29_RS13515 (OZF29_13515) | 17874..17957 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| OZF29_RS13520 (OZF29_13520) | 18082..18819 | + | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| OZF29_RS13525 (OZF29_13525) | 18823..19617 | + | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
| OZF29_RS13530 (OZF29_13530) | 20159..20242 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| OZF29_RS13535 (OZF29_13535) | 20367..21104 | + | 738 | WP_001038789.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| OZF29_RS13540 (OZF29_13540) | 21274..21534 | + | 261 | Protein_22 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| OZF29_RS13545 (OZF29_13545) | 21637..22533 | + | 897 | WP_002326827.1 | ParA family protein | - |
| OZF29_RS13550 (OZF29_13550) | 22625..22840 | + | 216 | WP_001835296.1 | peptide-binding protein | - |
| OZF29_RS13555 (OZF29_13555) | 22858..23130 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
| OZF29_RS13560 (OZF29_13560) | 23132..23995 | + | 864 | WP_002332783.1 | zeta toxin family protein | Toxin |
| OZF29_RS13565 (OZF29_13565) | 24435..24752 | + | 318 | WP_002326830.1 | hypothetical protein | - |
| OZF29_RS13570 (OZF29_13570) | 24952..25248 | + | 297 | WP_002311824.1 | hypothetical protein | - |
| OZF29_RS13575 (OZF29_13575) | 25255..27207 | + | 1953 | WP_000163792.1 | hypothetical protein | - |
| OZF29_RS13580 (OZF29_13580) | 27279..27776 | - | 498 | WP_000868795.1 | trimethoprim-resistant dihydrofolate reductase DfrG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | cat / tet(L) / tet(M) / erm(B) / aph(3')-III / dfrG | bsh | 1..73413 | 73413 | |
| - | flank | IS/Tn | erm(B) / aph(3')-III | - | 16688..21104 | 4416 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32675.27 Da Isoelectric Point: 7.3939
>T266128 WP_002332783.1 NZ_CP113833:23132-23995 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | P0A4M2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AF93 |