Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_26(antitoxin) |
Location | 2314857..2315552 | Replicon | chromosome |
Accession | NZ_CP113832 | ||
Organism | Enterococcus faecalis strain M61 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | - |
Locus tag | OZF29_RS11265 | Protein ID | WP_116543412.1 |
Coordinates | 2315208..2315552 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | OZF29_RS11260 | Protein ID | WP_116543410.1 |
Coordinates | 2314857..2315189 (+) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZF29_RS11200 (2309900) | 2309900..2310715 | - | 816 | WP_192436385.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
OZF29_RS11205 (2310678) | 2310678..2311694 | - | 1017 | WP_192436386.1 | RecT family recombinase | - |
OZF29_RS11210 (2311787) | 2311787..2312143 | - | 357 | WP_141416288.1 | hypothetical protein | - |
OZF29_RS11215 (2312146) | 2312146..2312370 | - | 225 | WP_002395803.1 | hypothetical protein | - |
OZF29_RS11220 (2312367) | 2312367..2312690 | - | 324 | WP_104681322.1 | hypothetical protein | - |
OZF29_RS11225 (2312758) | 2312758..2312937 | - | 180 | WP_025193409.1 | hypothetical protein | - |
OZF29_RS11230 (2312972) | 2312972..2313241 | - | 270 | WP_002365131.1 | hypothetical protein | - |
OZF29_RS11235 (2313317) | 2313317..2313631 | + | 315 | WP_010776102.1 | hypothetical protein | - |
OZF29_RS11240 (2313612) | 2313612..2313740 | - | 129 | WP_010776103.1 | hypothetical protein | - |
OZF29_RS11245 (2313887) | 2313887..2314069 | + | 183 | WP_104802089.1 | hypothetical protein | - |
OZF29_RS11250 (2314061) | 2314061..2314363 | - | 303 | WP_104802090.1 | hypothetical protein | - |
OZF29_RS11255 (2314376) | 2314376..2314558 | - | 183 | WP_104802091.1 | hypothetical protein | - |
OZF29_RS11260 (2314857) | 2314857..2315189 | + | 333 | WP_116543410.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OZF29_RS11265 (2315208) | 2315208..2315552 | + | 345 | WP_116543412.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
OZF29_RS11270 (2315640) | 2315640..2315822 | + | 183 | WP_010817602.1 | hypothetical protein | - |
OZF29_RS11275 (2315824) | 2315824..2316471 | - | 648 | WP_104802093.1 | hypothetical protein | - |
OZF29_RS11280 (2316662) | 2316662..2317843 | + | 1182 | WP_104844184.1 | site-specific integrase | - |
OZF29_RS11285 (2317946) | 2317946..2318095 | - | 150 | WP_002356321.1 | 50S ribosomal protein L33 | - |
OZF29_RS11290 (2318221) | 2318221..2320356 | - | 2136 | WP_116495276.1 | penicillin-binding protein 2 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13654.62 Da Isoelectric Point: 5.2241
>T266105 WP_116543412.1 NZ_CP113832:2315208-2315552 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMELYKLPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMELYKLPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|