Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_26(antitoxin)
Location 2314857..2315552 Replicon chromosome
Accession NZ_CP113832
Organism Enterococcus faecalis strain M61

Toxin (Protein)


Gene name IrrE Uniprot ID -
Locus tag OZF29_RS11265 Protein ID WP_116543412.1
Coordinates 2315208..2315552 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag OZF29_RS11260 Protein ID WP_116543410.1
Coordinates 2314857..2315189 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OZF29_RS11200 (2309900) 2309900..2310715 - 816 WP_192436385.1 PD-(D/E)XK nuclease-like domain-containing protein -
OZF29_RS11205 (2310678) 2310678..2311694 - 1017 WP_192436386.1 RecT family recombinase -
OZF29_RS11210 (2311787) 2311787..2312143 - 357 WP_141416288.1 hypothetical protein -
OZF29_RS11215 (2312146) 2312146..2312370 - 225 WP_002395803.1 hypothetical protein -
OZF29_RS11220 (2312367) 2312367..2312690 - 324 WP_104681322.1 hypothetical protein -
OZF29_RS11225 (2312758) 2312758..2312937 - 180 WP_025193409.1 hypothetical protein -
OZF29_RS11230 (2312972) 2312972..2313241 - 270 WP_002365131.1 hypothetical protein -
OZF29_RS11235 (2313317) 2313317..2313631 + 315 WP_010776102.1 hypothetical protein -
OZF29_RS11240 (2313612) 2313612..2313740 - 129 WP_010776103.1 hypothetical protein -
OZF29_RS11245 (2313887) 2313887..2314069 + 183 WP_104802089.1 hypothetical protein -
OZF29_RS11250 (2314061) 2314061..2314363 - 303 WP_104802090.1 hypothetical protein -
OZF29_RS11255 (2314376) 2314376..2314558 - 183 WP_104802091.1 hypothetical protein -
OZF29_RS11260 (2314857) 2314857..2315189 + 333 WP_116543410.1 helix-turn-helix transcriptional regulator Antitoxin
OZF29_RS11265 (2315208) 2315208..2315552 + 345 WP_116543412.1 ImmA/IrrE family metallo-endopeptidase Toxin
OZF29_RS11270 (2315640) 2315640..2315822 + 183 WP_010817602.1 hypothetical protein -
OZF29_RS11275 (2315824) 2315824..2316471 - 648 WP_104802093.1 hypothetical protein -
OZF29_RS11280 (2316662) 2316662..2317843 + 1182 WP_104844184.1 site-specific integrase -
OZF29_RS11285 (2317946) 2317946..2318095 - 150 WP_002356321.1 50S ribosomal protein L33 -
OZF29_RS11290 (2318221) 2318221..2320356 - 2136 WP_116495276.1 penicillin-binding protein 2 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(21-87)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-59)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13654.62 Da        Isoelectric Point: 5.2241

>T266105 WP_116543412.1 NZ_CP113832:2315208-2315552 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMELYKLPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12733.30 Da        Isoelectric Point: 5.9075

>AT266105 WP_116543410.1 NZ_CP113832:2314857-2315189 [Enterococcus faecalis]
MNTYEIIKELTKRKKMSIRQLEITLGYSNGYFSKWKKVSPNSEGLQKVADYFNVSVDYLLGRTDNTKATDEKNSDDLNDV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References