Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
Location | 2557572..2558258 | Replicon | chromosome |
Accession | NZ_CP113831 | ||
Organism | Enterococcus faecalis strain T30 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | - |
Locus tag | OZE10_RS13100 | Protein ID | WP_128722476.1 |
Coordinates | 2557914..2558258 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | OZE10_RS13095 | Protein ID | WP_010707137.1 |
Coordinates | 2557572..2557895 (+) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZE10_RS13035 (2552745) | 2552745..2553941 | - | 1197 | WP_128722493.1 | DEAD/DEAH box helicase | - |
OZE10_RS13040 (2553931) | 2553931..2554224 | - | 294 | WP_002418647.1 | VRR-NUC domain-containing protein | - |
OZE10_RS13045 (2554227) | 2554227..2554910 | - | 684 | WP_128722477.1 | DUF1642 domain-containing protein | - |
OZE10_RS13050 (2555022) | 2555022..2555216 | - | 195 | WP_010716255.1 | hypothetical protein | - |
OZE10_RS13055 (2555217) | 2555217..2555390 | - | 174 | WP_010773396.1 | hypothetical protein | - |
OZE10_RS13060 (2555396) | 2555396..2555596 | - | 201 | WP_002407633.1 | hypothetical protein | - |
OZE10_RS13065 (2555634) | 2555634..2555903 | - | 270 | WP_002365131.1 | hypothetical protein | - |
OZE10_RS13070 (2555979) | 2555979..2556293 | + | 315 | WP_002385638.1 | hypothetical protein | - |
OZE10_RS13075 (2556274) | 2556274..2556402 | - | 129 | WP_002385637.1 | hypothetical protein | - |
OZE10_RS13080 (2556418) | 2556418..2556594 | - | 177 | WP_002385636.1 | helix-turn-helix transcriptional regulator | - |
OZE10_RS13085 (2556678) | 2556678..2557061 | + | 384 | WP_002385635.1 | DUF2513 domain-containing protein | - |
OZE10_RS13090 (2557058) | 2557058..2557267 | - | 210 | WP_002415277.1 | DUF2829 domain-containing protein | - |
OZE10_RS13095 (2557572) | 2557572..2557895 | + | 324 | WP_010707137.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OZE10_RS13100 (2557914) | 2557914..2558258 | + | 345 | WP_128722476.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
OZE10_RS13105 (2558344) | 2558344..2558940 | + | 597 | WP_033781504.1 | DUF4352 domain-containing protein | - |
OZE10_RS13110 (2559117) | 2559117..2560298 | + | 1182 | WP_113813754.1 | site-specific integrase | - |
OZE10_RS13115 (2560401) | 2560401..2560550 | - | 150 | WP_002356321.1 | 50S ribosomal protein L33 | - |
OZE10_RS13120 (2560676) | 2560676..2562814 | - | 2139 | WP_024041710.1 | penicillin-binding transpeptidase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2483783..2560298 | 76515 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13670.65 Da Isoelectric Point: 5.6183
>T266083 WP_128722476.1 NZ_CP113831:2557914-2558258 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRAYFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMALYKIPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEIYLK
MKSIKELVEEYNVELVFTTLNKRAYFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMALYKIPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEIYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|