Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 49064..49635 | Replicon | plasmid pEFT30-1 |
| Accession | NZ_CP113829 | ||
| Organism | Enterococcus faecalis strain T30 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2Z2CGM4 |
| Locus tag | OZE10_RS00275 | Protein ID | WP_002362432.1 |
| Coordinates | 49064..49405 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | OZE10_RS00280 | Protein ID | WP_002362431.1 |
| Coordinates | 49405..49635 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZE10_RS00255 (OZE10_00255) | 44463..45746 | - | 1284 | Protein_50 | hypothetical protein | - |
| OZE10_RS00265 (OZE10_00265) | 47147..47749 | - | 603 | WP_002362434.1 | Fic family protein | - |
| OZE10_RS00270 (OZE10_00270) | 48014..48952 | - | 939 | WP_002362433.1 | hypothetical protein | - |
| OZE10_RS00275 (OZE10_00275) | 49064..49405 | - | 342 | WP_002362432.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OZE10_RS00280 (OZE10_00280) | 49405..49635 | - | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| OZE10_RS00285 (OZE10_00285) | 49839..50459 | + | 621 | WP_013438829.1 | recombinase family protein | - |
| OZE10_RS00290 (OZE10_00290) | 50476..50760 | + | 285 | WP_002394798.1 | hypothetical protein | - |
| OZE10_RS00295 (OZE10_00295) | 50762..50995 | + | 234 | WP_002394799.1 | hypothetical protein | - |
| OZE10_RS00300 (OZE10_00300) | 51155..51409 | - | 255 | WP_002394800.1 | hypothetical protein | - |
| OZE10_RS00305 (OZE10_00305) | 51526..52194 | - | 669 | WP_002394801.1 | CPBP family intramembrane metalloprotease | - |
| OZE10_RS00310 (OZE10_00310) | 52230..52547 | - | 318 | WP_002394802.1 | heavy metal-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(L) / tet(M) / fexA / optrA / erm(A) / erm(B) | - | 1..65374 | 65374 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13244.44 Da Isoelectric Point: 8.0113
>T266079 WP_002362432.1 NZ_CP113829:c49405-49064 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2Z2CGM4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R3KHK9 |