Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 5163596..5164115 Replicon chromosome
Accession NZ_CP113827
Organism Pandoraea sp. XJJ-1

Toxin (Protein)


Gene name relE Uniprot ID A0A9E9DDK2
Locus tag OYT13_RS23930 Protein ID WP_017233590.1
Coordinates 5163825..5164115 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A5E4X7B6
Locus tag OYT13_RS23925 Protein ID WP_017233589.1
Coordinates 5163596..5163838 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OYT13_RS23895 (OYT13_23895) 5158602..5159897 - 1296 WP_268567042.1 NAD(P)/FAD-dependent oxidoreductase -
OYT13_RS23900 (OYT13_23900) 5159908..5160423 - 516 WP_261939593.1 hypothetical protein -
OYT13_RS23905 (OYT13_23905) 5160456..5161223 - 768 WP_017233585.1 BON domain-containing protein -
OYT13_RS23910 (OYT13_23910) 5161342..5161929 - 588 WP_017233586.1 phosphoheptose isomerase -
OYT13_RS23915 (OYT13_23915) 5162084..5162437 - 354 WP_017233587.1 YraN family protein -
OYT13_RS23920 (OYT13_23920) 5162533..5163417 + 885 WP_017233588.1 16S rRNA (cytidine(1402)-2'-O)-methyltransferase -
OYT13_RS23925 (OYT13_23925) 5163596..5163838 + 243 WP_017233589.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
OYT13_RS23930 (OYT13_23930) 5163825..5164115 + 291 WP_017233590.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OYT13_RS23935 (OYT13_23935) 5164175..5164969 - 795 WP_017233591.1 ABC transporter ATP-binding protein -
OYT13_RS23940 (OYT13_23940) 5164972..5165877 - 906 WP_150564763.1 ABC transporter permease -
OYT13_RS23945 (OYT13_23945) 5166112..5167089 - 978 WP_085982690.1 ABC transporter substrate-binding protein -
OYT13_RS23950 (OYT13_23950) 5167544..5168161 - 618 WP_017233594.1 septal ring lytic transglycosylase RlpA family protein -
OYT13_RS23955 (OYT13_23955) 5168396..5169052 + 657 WP_268567043.1 MBL fold metallo-hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(7-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(9-68)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11180.11 Da        Isoelectric Point: 11.0516

>T266077 WP_017233590.1 NZ_CP113827:5163825-5164115 [Pandoraea sp. XJJ-1]
MTTYDLQFLPSALKEWQALDSTIQRQFKAKLQQRLQRPQVPGSRLRSMPDCYKIKLASVGYRLVYRVDDKAVTVLVVAVG
KREHLATYRTARKRVQ

Download         Length: 291 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8581.72 Da        Isoelectric Point: 4.4865

>AT266077 WP_017233589.1 NZ_CP113827:5163596-5163838 [Pandoraea sp. XJJ-1]
MKNILARASIGISELKSNPSAAIHRADGPVAILNRNTPVAYLVPAADWEAICERLDDAELADLIRSRAGETPVSTQLDDL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E4X7B6

References