Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hipBA/HipA-couple_hipB |
Location | 1216225..1217766 | Replicon | chromosome |
Accession | NZ_CP113808 | ||
Organism | Shewanella sp. DAU305 |
Toxin (Protein)
Gene name | hipA | Uniprot ID | - |
Locus tag | OX890_RS05295 | Protein ID | WP_268650205.1 |
Coordinates | 1216465..1217766 (+) | Length | 434 a.a. |
Antitoxin (Protein)
Gene name | hipB | Uniprot ID | - |
Locus tag | OX890_RS05290 | Protein ID | WP_220591948.1 |
Coordinates | 1216225..1216461 (+) | Length | 79 a.a. |
Genomic Context
Location: 1211246..1212235 (990 bp)
Type: Others
Protein ID: WP_268650595.1
Type: Others
Protein ID: WP_268650595.1
Location: 1213829..1214119 (291 bp)
Type: Others
Protein ID: WP_006086113.1
Type: Others
Protein ID: WP_006086113.1
Location: 1214177..1215814 (1638 bp)
Type: Others
Protein ID: WP_012196636.1
Type: Others
Protein ID: WP_012196636.1
Location: 1216225..1216461 (237 bp)
Type: Antitoxin
Protein ID: WP_220591948.1
Type: Antitoxin
Protein ID: WP_220591948.1
Location: 1216465..1217766 (1302 bp)
Type: Toxin
Protein ID: WP_268650205.1
Type: Toxin
Protein ID: WP_268650205.1
Location: 1217864..1218538 (675 bp)
Type: Others
Protein ID: WP_268650206.1
Type: Others
Protein ID: WP_268650206.1
Location: 1219297..1219872 (576 bp)
Type: Others
Protein ID: WP_268650207.1
Type: Others
Protein ID: WP_268650207.1
Location: 1219989..1220375 (387 bp)
Type: Others
Protein ID: WP_219253638.1
Type: Others
Protein ID: WP_219253638.1
Location: 1220952..1222448 (1497 bp)
Type: Others
Protein ID: WP_268650209.1
Type: Others
Protein ID: WP_268650209.1
Location: 1212237..1213604 (1368 bp)
Type: Others
Protein ID: WP_268650204.1
Type: Others
Protein ID: WP_268650204.1
Location: 1220534..1220785 (252 bp)
Type: Others
Protein ID: WP_268650208.1
Type: Others
Protein ID: WP_268650208.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OX890_RS05270 (OX890_05270) | 1211246..1212235 | + | 990 | WP_268650595.1 | LysR family transcriptional regulator | - |
OX890_RS05275 (OX890_05275) | 1212237..1213604 | - | 1368 | WP_268650204.1 | MATE family efflux transporter | - |
OX890_RS05280 (OX890_05280) | 1213829..1214119 | + | 291 | WP_006086113.1 | co-chaperone GroES | - |
OX890_RS05285 (OX890_05285) | 1214177..1215814 | + | 1638 | WP_012196636.1 | chaperonin GroEL | - |
OX890_RS05290 (OX890_05290) | 1216225..1216461 | + | 237 | WP_220591948.1 | helix-turn-helix domain-containing protein | Antitoxin |
OX890_RS05295 (OX890_05295) | 1216465..1217766 | + | 1302 | WP_268650205.1 | HipA domain-containing protein | Toxin |
OX890_RS05300 (OX890_05300) | 1217864..1218538 | + | 675 | WP_268650206.1 | HNH endonuclease | - |
OX890_RS05305 (OX890_05305) | 1219297..1219872 | + | 576 | WP_268650207.1 | hypothetical protein | - |
OX890_RS05310 (OX890_05310) | 1219989..1220375 | + | 387 | WP_219253638.1 | carboxymuconolactone decarboxylase family protein | - |
OX890_RS05315 (OX890_05315) | 1220534..1220785 | - | 252 | WP_268650208.1 | DUF2999 family protein | - |
OX890_RS05320 (OX890_05320) | 1220952..1222448 | + | 1497 | WP_268650209.1 | ATP-binding cassette domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 434 a.a. Molecular weight: 48590.87 Da Isoelectric Point: 5.8621
>T266070 WP_268650205.1 NZ_CP113808:1216465-1217766 [Shewanella sp. DAU305]
MSTSKKLTLEMHLGDLIIGELSFDATTDTFAVHYTKHWQQSGFPLSPTIPLDGTGSSSQISMFLVNLLPENKGLDYLIES
LGVSKGNTFALIRAIGLDTAGAVAFVPKGTLLPETQLRPIKAEEVIQRIEDPTMWPMEIWDGKPRLSVAGVQPKLNLFYN
GEEFAFAEGALSSTHIVKFEKYRHLVLNEFMTMRLAKAIGMNVANVDIVHFGDYKVLCVERFDRRYMPNEQRVLRRHIVD
SCQALGFSVSKKYERNFGSGRDVKDIREGVSFNRLFSLAVKCRNPVAAKQDMLQWALFNLLTGNADAHGKNYSFFMTPSG
MEPTPWYDLVSVAMYEDFEQQLAMAIDDEFDPNSIYAYQLAAFIDGLGLPRNLLISNLTSIAQRIPQAIAEVVSMLPALD
ESETVFVAHYKAQLLARCDRYLSFAAEVRDVKV
MSTSKKLTLEMHLGDLIIGELSFDATTDTFAVHYTKHWQQSGFPLSPTIPLDGTGSSSQISMFLVNLLPENKGLDYLIES
LGVSKGNTFALIRAIGLDTAGAVAFVPKGTLLPETQLRPIKAEEVIQRIEDPTMWPMEIWDGKPRLSVAGVQPKLNLFYN
GEEFAFAEGALSSTHIVKFEKYRHLVLNEFMTMRLAKAIGMNVANVDIVHFGDYKVLCVERFDRRYMPNEQRVLRRHIVD
SCQALGFSVSKKYERNFGSGRDVKDIREGVSFNRLFSLAVKCRNPVAAKQDMLQWALFNLLTGNADAHGKNYSFFMTPSG
MEPTPWYDLVSVAMYEDFEQQLAMAIDDEFDPNSIYAYQLAAFIDGLGLPRNLLISNLTSIAQRIPQAIAEVVSMLPALD
ESETVFVAHYKAQLLARCDRYLSFAAEVRDVKV
Download Length: 1302 bp