Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pezAT/zeta-ParD |
| Location | 2927474..2928426 | Replicon | chromosome |
| Accession | NZ_CP113798 | ||
| Organism | Rhodococcus pyridinivorans strain P23 | ||
Toxin (Protein)
| Gene name | pezT | Uniprot ID | - |
| Locus tag | OQN32_RS13480 | Protein ID | WP_159418169.1 |
| Coordinates | 2927474..2928043 (-) | Length | 190 a.a. |
Antitoxin (Protein)
| Gene name | pezA | Uniprot ID | - |
| Locus tag | OQN32_RS13485 | Protein ID | WP_120282896.1 |
| Coordinates | 2928040..2928426 (-) | Length | 129 a.a. |
Genomic Context
Location: 2922655..2923770 (1116 bp)
Type: Others
Protein ID: WP_159418172.1
Type: Others
Protein ID: WP_159418172.1
Location: 2923814..2924761 (948 bp)
Type: Others
Protein ID: WP_268653750.1
Type: Others
Protein ID: WP_268653750.1
Location: 2924754..2925692 (939 bp)
Type: Others
Protein ID: WP_120282890.1
Type: Others
Protein ID: WP_120282890.1
Location: 2925718..2927442 (1725 bp)
Type: Others
Protein ID: WP_120282892.1
Type: Others
Protein ID: WP_120282892.1
Location: 2928632..2929702 (1071 bp)
Type: Others
Protein ID: WP_159418168.1
Type: Others
Protein ID: WP_159418168.1
Location: 2929772..2930137 (366 bp)
Type: Others
Protein ID: WP_120282900.1
Type: Others
Protein ID: WP_120282900.1
Location: 2927474..2928043 (570 bp)
Type: Toxin
Protein ID: WP_159418169.1
Type: Toxin
Protein ID: WP_159418169.1
Location: 2928040..2928426 (387 bp)
Type: Antitoxin
Protein ID: WP_120282896.1
Type: Antitoxin
Protein ID: WP_120282896.1
Location: 2931534..2932466 (933 bp)
Type: Others
Protein ID: WP_159418167.1
Type: Others
Protein ID: WP_159418167.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQN32_RS13460 (OQN32_13460) | 2922655..2923770 | + | 1116 | WP_159418172.1 | FAD-dependent monooxygenase | - |
| OQN32_RS13465 (OQN32_13465) | 2923814..2924761 | + | 948 | WP_268653750.1 | alpha/beta hydrolase | - |
| OQN32_RS13470 (OQN32_13470) | 2924754..2925692 | + | 939 | WP_120282890.1 | MBL fold metallo-hydrolase | - |
| OQN32_RS13475 (OQN32_13475) | 2925718..2927442 | + | 1725 | WP_120282892.1 | CocE/NonD family hydrolase | - |
| OQN32_RS13480 (OQN32_13480) | 2927474..2928043 | - | 570 | WP_159418169.1 | zeta toxin family protein | Toxin |
| OQN32_RS13485 (OQN32_13485) | 2928040..2928426 | - | 387 | WP_120282896.1 | hypothetical protein | Antitoxin |
| OQN32_RS13490 (OQN32_13490) | 2928632..2929702 | + | 1071 | WP_159418168.1 | class I SAM-dependent methyltransferase | - |
| OQN32_RS13495 (OQN32_13495) | 2929772..2930137 | + | 366 | WP_120282900.1 | HNH endonuclease | - |
| OQN32_RS13500 (OQN32_13500) | 2931534..2932466 | - | 933 | WP_159418167.1 | TAXI family TRAP transporter solute-binding subunit | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 190 a.a. Molecular weight: 20510.63 Da Isoelectric Point: 10.6895
>T266064 WP_159418169.1 NZ_CP113798:c2928043-2927474 [Rhodococcus pyridinivorans]
MRRLDLIVGPNGSGKSTFVELSLAPLLPRSVFVNADVIARQRWPDRAEEMSYEAAQLAAAARDRLLRQGRSFIAETVFSH
PSKLELIDRAHEAGFTVVLHVMLVPETMSVLRVQHRVASGGHAVPEDKIRARYRRLWPLVAEAIGRADQASVYDTASGTP
VVVARFAGGVPVGAVRWPGWAPGALTGLG
MRRLDLIVGPNGSGKSTFVELSLAPLLPRSVFVNADVIARQRWPDRAEEMSYEAAQLAAAARDRLLRQGRSFIAETVFSH
PSKLELIDRAHEAGFTVVLHVMLVPETMSVLRVQHRVASGGHAVPEDKIRARYRRLWPLVAEAIGRADQASVYDTASGTP
VVVARFAGGVPVGAVRWPGWAPGALTGLG
Download Length: 570 bp
Antitoxin
Download Length: 129 a.a. Molecular weight: 14080.57 Da Isoelectric Point: 4.7096
>AT266064 WP_120282896.1 NZ_CP113798:c2928426-2928040 [Rhodococcus pyridinivorans]
MTSSTDKVTRFDAELVDSAIAEGGRQNRTGRQQLEYWARIGRAMTAHETASLHRVHEALAGTRELSELTAAEGRLFDAEI
DARLADGLARTDYVEILAARGVTTVVLDDEGRLVEQRPDGSRRVLDDA
MTSSTDKVTRFDAELVDSAIAEGGRQNRTGRQQLEYWARIGRAMTAHETASLHRVHEALAGTRELSELTAAEGRLFDAEI
DARLADGLARTDYVEILAARGVTTVVLDDEGRLVEQRPDGSRRVLDDA
Download Length: 387 bp