Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1706983..1707557 | Replicon | chromosome |
| Accession | NZ_CP113797 | ||
| Organism | Leptolyngbya sp. PKUAC-SCTA174 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | OXH18_RS07435 | Protein ID | WP_268611854.1 |
| Coordinates | 1707219..1707557 (+) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | OXH18_RS07430 | Protein ID | WP_268611853.1 |
| Coordinates | 1706983..1707219 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXH18_RS07390 (OXH18_07390) | 1702165..1702332 | - | 168 | WP_268611842.1 | hypothetical protein | - |
| OXH18_RS07395 (OXH18_07395) | 1702523..1702825 | + | 303 | WP_268611843.1 | hypothetical protein | - |
| OXH18_RS07400 (OXH18_07400) | 1702813..1703049 | + | 237 | WP_268611845.1 | hypothetical protein | - |
| OXH18_RS07405 (OXH18_07405) | 1703182..1703679 | - | 498 | WP_268611846.1 | DUF3368 domain-containing protein | - |
| OXH18_RS07410 (OXH18_07410) | 1703676..1703921 | - | 246 | WP_268611848.1 | UPF0175 family protein | - |
| OXH18_RS07415 (OXH18_07415) | 1704195..1704842 | + | 648 | WP_268611850.1 | HNH endonuclease | - |
| OXH18_RS07420 (OXH18_07420) | 1705008..1705817 | + | 810 | WP_268611851.1 | SDR family oxidoreductase | - |
| OXH18_RS07425 (OXH18_07425) | 1705972..1706724 | + | 753 | WP_268611852.1 | nitroreductase family protein | - |
| OXH18_RS07430 (OXH18_07430) | 1706983..1707219 | + | 237 | WP_268611853.1 | hypothetical protein | Antitoxin |
| OXH18_RS07435 (OXH18_07435) | 1707219..1707557 | + | 339 | WP_268611854.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OXH18_RS07440 (OXH18_07440) | 1707750..1707941 | - | 192 | WP_268611855.1 | hypothetical protein | - |
| OXH18_RS07445 (OXH18_07445) | 1708111..1708416 | + | 306 | WP_268613141.1 | c-type cytochrome | - |
| OXH18_RS07450 (OXH18_07450) | 1708555..1708902 | - | 348 | WP_268611857.1 | hypothetical protein | - |
| OXH18_RS07455 (OXH18_07455) | 1709066..1710727 | - | 1662 | WP_268611858.1 | glycosyltransferase family 39 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12651.55 Da Isoelectric Point: 4.5702
>T266062 WP_268611854.1 NZ_CP113797:1707219-1707557 [Leptolyngbya sp. PKUAC-SCTA174]
MYRGEIWWANLPNPVGSEPGYRRPVLVIQDDTFTQSRIRTIIVVIITSNVQLAEAPGNVLLPREVSGLPRDSVVNISQIF
TVNKTFLVERVGALPDYLQEEVDEGLRTILYL
MYRGEIWWANLPNPVGSEPGYRRPVLVIQDDTFTQSRIRTIIVVIITSNVQLAEAPGNVLLPREVSGLPRDSVVNISQIF
TVNKTFLVERVGALPDYLQEEVDEGLRTILYL
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|