Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 54597..55122 | Replicon | plasmid pBSKP3 |
| Accession | NZ_CP113792 | ||
| Organism | Klebsiella variicola subsp. tropica strain BSK_177V2 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | D4HQE7 |
| Locus tag | OUI59_RS29175 | Protein ID | WP_013023785.1 |
| Coordinates | 54817..55122 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | W8V2V6 |
| Locus tag | OUI59_RS29170 | Protein ID | WP_001568025.1 |
| Coordinates | 54597..54815 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OUI59_RS29130 (OUI59_29130) | 49988..50191 | - | 204 | WP_004197809.1 | hypothetical protein | - |
| OUI59_RS29135 (OUI59_29135) | 50205..50408 | - | 204 | WP_004197808.1 | HHA domain-containing protein | - |
| OUI59_RS29140 (OUI59_29140) | 50442..50810 | - | 369 | WP_004197807.1 | hypothetical protein | - |
| OUI59_RS29145 (OUI59_29145) | 50854..51348 | - | 495 | WP_020805591.1 | hypothetical protein | - |
| OUI59_RS29150 (OUI59_29150) | 51379..51951 | - | 573 | WP_020805590.1 | hypothetical protein | - |
| OUI59_RS29155 (OUI59_29155) | 51948..52196 | - | 249 | WP_000272716.1 | hypothetical protein | - |
| OUI59_RS29160 (OUI59_29160) | 52633..53322 | + | 690 | WP_020315560.1 | RES family NAD+ phosphorylase | - |
| OUI59_RS29165 (OUI59_29165) | 53354..54043 | - | 690 | WP_004193995.1 | hypothetical protein | - |
| OUI59_RS29170 (OUI59_29170) | 54597..54815 | + | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| OUI59_RS29175 (OUI59_29175) | 54817..55122 | + | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| OUI59_RS29180 (OUI59_29180) | 55309..56313 | + | 1005 | WP_001568027.1 | hypothetical protein | - |
| OUI59_RS29185 (OUI59_29185) | 56497..57276 | + | 780 | WP_001568028.1 | site-specific integrase | - |
| OUI59_RS29190 (OUI59_29190) | 57334..57591 | - | 258 | WP_000764642.1 | hypothetical protein | - |
| OUI59_RS29195 (OUI59_29195) | 57720..57833 | - | 114 | WP_014343462.1 | hypothetical protein | - |
| OUI59_RS29200 (OUI59_29200) | 58464..59219 | + | 756 | WP_001568031.1 | replication initiation protein RepE | - |
| OUI59_RS29205 (OUI59_29205) | 59509..59799 | - | 291 | WP_225376351.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaTEM-1B / tet(D) / dfrA5 / qacE / sul2 / aph(6)-Id / aph(3'')-Ib | - | 1..92624 | 92624 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T266061 WP_013023785.1 NZ_CP113792:54817-55122 [Klebsiella variicola subsp. tropica]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZP8 |