Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 54597..55122 Replicon plasmid pBSKP3
Accession NZ_CP113792
Organism Klebsiella variicola subsp. tropica strain BSK_177V2

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag OUI59_RS29175 Protein ID WP_013023785.1
Coordinates 54817..55122 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag OUI59_RS29170 Protein ID WP_001568025.1
Coordinates 54597..54815 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OUI59_RS29130 (OUI59_29130) 49988..50191 - 204 WP_004197809.1 hypothetical protein -
OUI59_RS29135 (OUI59_29135) 50205..50408 - 204 WP_004197808.1 HHA domain-containing protein -
OUI59_RS29140 (OUI59_29140) 50442..50810 - 369 WP_004197807.1 hypothetical protein -
OUI59_RS29145 (OUI59_29145) 50854..51348 - 495 WP_020805591.1 hypothetical protein -
OUI59_RS29150 (OUI59_29150) 51379..51951 - 573 WP_020805590.1 hypothetical protein -
OUI59_RS29155 (OUI59_29155) 51948..52196 - 249 WP_000272716.1 hypothetical protein -
OUI59_RS29160 (OUI59_29160) 52633..53322 + 690 WP_020315560.1 RES family NAD+ phosphorylase -
OUI59_RS29165 (OUI59_29165) 53354..54043 - 690 WP_004193995.1 hypothetical protein -
OUI59_RS29170 (OUI59_29170) 54597..54815 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
OUI59_RS29175 (OUI59_29175) 54817..55122 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
OUI59_RS29180 (OUI59_29180) 55309..56313 + 1005 WP_001568027.1 hypothetical protein -
OUI59_RS29185 (OUI59_29185) 56497..57276 + 780 WP_001568028.1 site-specific integrase -
OUI59_RS29190 (OUI59_29190) 57334..57591 - 258 WP_000764642.1 hypothetical protein -
OUI59_RS29195 (OUI59_29195) 57720..57833 - 114 WP_014343462.1 hypothetical protein -
OUI59_RS29200 (OUI59_29200) 58464..59219 + 756 WP_001568031.1 replication initiation protein RepE -
OUI59_RS29205 (OUI59_29205) 59509..59799 - 291 WP_225376351.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaTEM-1B / tet(D) / dfrA5 / qacE / sul2 / aph(6)-Id / aph(3'')-Ib - 1..92624 92624


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T266061 WP_013023785.1 NZ_CP113792:54817-55122 [Klebsiella variicola subsp. tropica]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT266061 WP_001568025.1 NZ_CP113792:54597-54815 [Klebsiella variicola subsp. tropica]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References