Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 56569..57305 | Replicon | plasmid pBSKP1 |
Accession | NZ_CP113790 | ||
Organism | Klebsiella variicola subsp. tropica strain BSK_177V2 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | OUI59_RS27765 | Protein ID | WP_003026803.1 |
Coordinates | 56823..57305 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | OUI59_RS27760 | Protein ID | WP_003026799.1 |
Coordinates | 56569..56835 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OUI59_RS27740 (OUI59_27740) | 51914..53731 | + | 1818 | WP_000925242.1 | multicopper oxidase PcoA | - |
OUI59_RS27745 (OUI59_27745) | 53737..54627 | + | 891 | WP_001378118.1 | copper resistance outer membrane transporter PcoB | - |
OUI59_RS27750 (OUI59_27750) | 54667..55050 | + | 384 | WP_268657995.1 | copper resistance system metallochaperone PcoC | - |
OUI59_RS27755 (OUI59_27755) | 55072..56040 | + | 969 | WP_072202995.1 | IS5 family transposase | - |
OUI59_RS27760 (OUI59_27760) | 56569..56835 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
OUI59_RS27765 (OUI59_27765) | 56823..57305 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
OUI59_RS27770 (OUI59_27770) | 57517..58863 | + | 1347 | WP_077251107.1 | ISNCY family transposase | - |
OUI59_RS27775 (OUI59_27775) | 59023..59727 | + | 705 | WP_031591821.1 | toll/interleukin-1 receptor domain-containing protein | - |
OUI59_RS27780 (OUI59_27780) | 60062..60319 | - | 258 | WP_023292103.1 | hypothetical protein | - |
OUI59_RS27785 (OUI59_27785) | 60961..61476 | + | 516 | Protein_66 | CSS-motif domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..154584 | 154584 | |
- | inside | IScluster/Tn | - | - | 55072..58863 | 3791 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T266060 WP_003026803.1 NZ_CP113790:56823-57305 [Klebsiella variicola subsp. tropica]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |