Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 14701..15344 Replicon plasmid pBSKP1
Accession NZ_CP113790
Organism Klebsiella variicola subsp. tropica strain BSK_177V2

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag OUI59_RS27525 Protein ID WP_021312475.1
Coordinates 14928..15344 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A6B7Q5S4
Locus tag OUI59_RS27520 Protein ID WP_021312476.1
Coordinates 14701..14931 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OUI59_RS27495 (OUI59_27495) 10044..10772 + 729 Protein_8 CSS-motif domain-containing protein -
OUI59_RS27500 (OUI59_27500) 10824..11624 + 801 WP_065905270.1 EAL domain-containing protein -
OUI59_RS27505 (OUI59_27505) 12311..13279 - 969 WP_268657378.1 IS5-like element IS903 family transposase -
OUI59_RS27510 (OUI59_27510) 13281..13754 - 474 WP_065905236.1 hypothetical protein -
OUI59_RS27515 (OUI59_27515) 13803..14096 - 294 WP_124989603.1 hypothetical protein -
OUI59_RS27520 (OUI59_27520) 14701..14931 + 231 WP_021312476.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OUI59_RS27525 (OUI59_27525) 14928..15344 + 417 WP_021312475.1 type II toxin-antitoxin system VapC family toxin Toxin
OUI59_RS27530 (OUI59_27530) 15379..15624 + 246 WP_065905238.1 hypothetical protein -
OUI59_RS27535 (OUI59_27535) 15688..15906 + 219 WP_021312527.1 hypothetical protein -
OUI59_RS27540 (OUI59_27540) 15985..16311 + 327 WP_124989605.1 hypothetical protein -
OUI59_RS27545 (OUI59_27545) 16551..16814 + 264 WP_004118691.1 hypothetical protein -
OUI59_RS27550 (OUI59_27550) 16811..17377 + 567 WP_009654312.1 hypothetical protein -
OUI59_RS27555 (OUI59_27555) 17408..17902 + 495 WP_016528789.1 hypothetical protein -
OUI59_RS27560 (OUI59_27560) 17963..18166 + 204 WP_004150739.1 HHA domain-containing protein -
OUI59_RS27565 (OUI59_27565) 18215..18472 + 258 WP_004098928.1 hypothetical protein -
OUI59_RS27570 (OUI59_27570) 18548..18802 + 255 WP_032731922.1 hypothetical protein -
OUI59_RS27575 (OUI59_27575) 19101..20105 - 1005 WP_065905242.1 IS110-like element IS5075 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..154584 154584
- flank IS/Tn - - 12311..13279 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15033.44 Da        Isoelectric Point: 7.8915

>T266059 WP_021312475.1 NZ_CP113790:14928-15344 [Klebsiella variicola subsp. tropica]
VKKTFMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRQAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLVLEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8723.76 Da        Isoelectric Point: 4.3410

>AT266059 WP_021312476.1 NZ_CP113790:14701-14931 [Klebsiella variicola subsp. tropica]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFDL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A6B7Q5S4

References