Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 14701..15344 | Replicon | plasmid pBSKP1 |
| Accession | NZ_CP113790 | ||
| Organism | Klebsiella variicola subsp. tropica strain BSK_177V2 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | OUI59_RS27525 | Protein ID | WP_021312475.1 |
| Coordinates | 14928..15344 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A6B7Q5S4 |
| Locus tag | OUI59_RS27520 | Protein ID | WP_021312476.1 |
| Coordinates | 14701..14931 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OUI59_RS27495 (OUI59_27495) | 10044..10772 | + | 729 | Protein_8 | CSS-motif domain-containing protein | - |
| OUI59_RS27500 (OUI59_27500) | 10824..11624 | + | 801 | WP_065905270.1 | EAL domain-containing protein | - |
| OUI59_RS27505 (OUI59_27505) | 12311..13279 | - | 969 | WP_268657378.1 | IS5-like element IS903 family transposase | - |
| OUI59_RS27510 (OUI59_27510) | 13281..13754 | - | 474 | WP_065905236.1 | hypothetical protein | - |
| OUI59_RS27515 (OUI59_27515) | 13803..14096 | - | 294 | WP_124989603.1 | hypothetical protein | - |
| OUI59_RS27520 (OUI59_27520) | 14701..14931 | + | 231 | WP_021312476.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OUI59_RS27525 (OUI59_27525) | 14928..15344 | + | 417 | WP_021312475.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OUI59_RS27530 (OUI59_27530) | 15379..15624 | + | 246 | WP_065905238.1 | hypothetical protein | - |
| OUI59_RS27535 (OUI59_27535) | 15688..15906 | + | 219 | WP_021312527.1 | hypothetical protein | - |
| OUI59_RS27540 (OUI59_27540) | 15985..16311 | + | 327 | WP_124989605.1 | hypothetical protein | - |
| OUI59_RS27545 (OUI59_27545) | 16551..16814 | + | 264 | WP_004118691.1 | hypothetical protein | - |
| OUI59_RS27550 (OUI59_27550) | 16811..17377 | + | 567 | WP_009654312.1 | hypothetical protein | - |
| OUI59_RS27555 (OUI59_27555) | 17408..17902 | + | 495 | WP_016528789.1 | hypothetical protein | - |
| OUI59_RS27560 (OUI59_27560) | 17963..18166 | + | 204 | WP_004150739.1 | HHA domain-containing protein | - |
| OUI59_RS27565 (OUI59_27565) | 18215..18472 | + | 258 | WP_004098928.1 | hypothetical protein | - |
| OUI59_RS27570 (OUI59_27570) | 18548..18802 | + | 255 | WP_032731922.1 | hypothetical protein | - |
| OUI59_RS27575 (OUI59_27575) | 19101..20105 | - | 1005 | WP_065905242.1 | IS110-like element IS5075 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..154584 | 154584 | |
| - | flank | IS/Tn | - | - | 12311..13279 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15033.44 Da Isoelectric Point: 7.8915
>T266059 WP_021312475.1 NZ_CP113790:14928-15344 [Klebsiella variicola subsp. tropica]
VKKTFMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRQAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLVLEDWVN
VKKTFMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRQAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLVLEDWVN
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|