Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5526730..5527355 | Replicon | chromosome |
Accession | NZ_CP113789 | ||
Organism | Klebsiella variicola subsp. tropica strain BSK_177V2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | OUI59_RS27075 | Protein ID | WP_002882817.1 |
Coordinates | 5526730..5527113 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | OUI59_RS27080 | Protein ID | WP_004150355.1 |
Coordinates | 5527113..5527355 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OUI59_RS27060 (OUI59_27060) | 5524096..5524998 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
OUI59_RS27065 (OUI59_27065) | 5524995..5525630 | + | 636 | WP_061156261.1 | formate dehydrogenase cytochrome b556 subunit | - |
OUI59_RS27070 (OUI59_27070) | 5525627..5526556 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
OUI59_RS27075 (OUI59_27075) | 5526730..5527113 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OUI59_RS27080 (OUI59_27080) | 5527113..5527355 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
OUI59_RS27085 (OUI59_27085) | 5527560..5528477 | + | 918 | WP_074387461.1 | alpha/beta hydrolase | - |
OUI59_RS27090 (OUI59_27090) | 5528492..5529433 | - | 942 | WP_165784254.1 | fatty acid biosynthesis protein FabY | - |
OUI59_RS27095 (OUI59_27095) | 5529478..5529915 | - | 438 | WP_012543288.1 | D-aminoacyl-tRNA deacylase | - |
OUI59_RS27100 (OUI59_27100) | 5529912..5530772 | - | 861 | WP_074387464.1 | virulence factor BrkB family protein | - |
OUI59_RS27105 (OUI59_27105) | 5530766..5531365 | - | 600 | WP_100632113.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T266058 WP_002882817.1 NZ_CP113789:c5527113-5526730 [Klebsiella variicola subsp. tropica]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |