Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4962788..4963489 Replicon chromosome
Accession NZ_CP113789
Organism Klebsiella variicola subsp. tropica strain BSK_177V2

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag OUI59_RS24405 Protein ID WP_126765581.1
Coordinates 4962788..4963108 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag OUI59_RS24410 Protein ID WP_047037235.1
Coordinates 4963145..4963489 (-) Length 115 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OUI59_RS24375 (OUI59_24375) 4958456..4959130 + 675 WP_074387214.1 hypothetical protein -
OUI59_RS24380 (OUI59_24380) 4959132..4959479 + 348 WP_074387215.1 hypothetical protein -
OUI59_RS24385 (OUI59_24385) 4959482..4959961 + 480 WP_004192264.1 type VI secretion system tube protein TssD -
OUI59_RS24390 (OUI59_24390) 4960275..4960385 - 111 Protein_4786 DUF4102 domain-containing protein -
OUI59_RS24395 (OUI59_24395) 4960759..4961766 - 1008 WP_004216518.1 restriction endonuclease -
OUI59_RS24400 (OUI59_24400) 4961844..4962674 - 831 WP_126765583.1 DUF4942 domain-containing protein -
OUI59_RS24405 (OUI59_24405) 4962788..4963108 - 321 WP_126765581.1 TA system toxin CbtA family protein Toxin
OUI59_RS24410 (OUI59_24410) 4963145..4963489 - 345 WP_047037235.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OUI59_RS24415 (OUI59_24415) 4963512..4963733 - 222 WP_126765579.1 DUF987 family protein -
OUI59_RS24420 (OUI59_24420) 4963747..4964226 - 480 WP_047037236.1 DNA repair protein RadC -
OUI59_RS24425 (OUI59_24425) 4964238..4964681 - 444 WP_268657465.1 antirestriction protein -
OUI59_RS24430 (OUI59_24430) 4964712..4965533 - 822 WP_268657466.1 DUF932 domain-containing protein -
OUI59_RS24435 (OUI59_24435) 4965653..4966126 - 474 WP_126766064.1 hypothetical protein -
OUI59_RS24440 (OUI59_24440) 4966197..4966649 - 453 WP_126766061.1 hypothetical protein -
OUI59_RS24445 (OUI59_24445) 4966685..4967401 - 717 WP_126766059.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4958009..4998214 40205


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(12-105)

Antitoxin

Antitoxin CbeA

(14-112)


Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12148.90 Da        Isoelectric Point: 6.3215

>T266057 WP_126765581.1 NZ_CP113789:c4963108-4962788 [Klebsiella variicola subsp. tropica]
MHISSVPATVPVSSRLPPVQVWQQLLTYLLEHHYGLMLNDTPFHDDTAIQEHIEAGITLADAVNFLVERYELVRTYRKGF
SWQEQTPFLTAVDILRARRATGLMNT

Download         Length: 321 bp

Antitoxin


Download         Length: 115 a.a.        Molecular weight: 12794.49 Da        Isoelectric Point: 6.4666

>AT266057 WP_047037235.1 NZ_CP113789:c4963489-4963145 [Klebsiella variicola subsp. tropica]
MSNKTPSDHDVSEPWWGLERDITPCFGARLVQEGNRLHYLADRAGLAGSFSPEQLQKLDKAFPLYIDQLEAMLCSGELNP
RQRHQVSIHLTGLTCIADTRGSCGYVYLTIYPGR

Download         Length: 345 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References