Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4962788..4963489 | Replicon | chromosome |
| Accession | NZ_CP113789 | ||
| Organism | Klebsiella variicola subsp. tropica strain BSK_177V2 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | OUI59_RS24405 | Protein ID | WP_126765581.1 |
| Coordinates | 4962788..4963108 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | OUI59_RS24410 | Protein ID | WP_047037235.1 |
| Coordinates | 4963145..4963489 (-) | Length | 115 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OUI59_RS24375 (OUI59_24375) | 4958456..4959130 | + | 675 | WP_074387214.1 | hypothetical protein | - |
| OUI59_RS24380 (OUI59_24380) | 4959132..4959479 | + | 348 | WP_074387215.1 | hypothetical protein | - |
| OUI59_RS24385 (OUI59_24385) | 4959482..4959961 | + | 480 | WP_004192264.1 | type VI secretion system tube protein TssD | - |
| OUI59_RS24390 (OUI59_24390) | 4960275..4960385 | - | 111 | Protein_4786 | DUF4102 domain-containing protein | - |
| OUI59_RS24395 (OUI59_24395) | 4960759..4961766 | - | 1008 | WP_004216518.1 | restriction endonuclease | - |
| OUI59_RS24400 (OUI59_24400) | 4961844..4962674 | - | 831 | WP_126765583.1 | DUF4942 domain-containing protein | - |
| OUI59_RS24405 (OUI59_24405) | 4962788..4963108 | - | 321 | WP_126765581.1 | TA system toxin CbtA family protein | Toxin |
| OUI59_RS24410 (OUI59_24410) | 4963145..4963489 | - | 345 | WP_047037235.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OUI59_RS24415 (OUI59_24415) | 4963512..4963733 | - | 222 | WP_126765579.1 | DUF987 family protein | - |
| OUI59_RS24420 (OUI59_24420) | 4963747..4964226 | - | 480 | WP_047037236.1 | DNA repair protein RadC | - |
| OUI59_RS24425 (OUI59_24425) | 4964238..4964681 | - | 444 | WP_268657465.1 | antirestriction protein | - |
| OUI59_RS24430 (OUI59_24430) | 4964712..4965533 | - | 822 | WP_268657466.1 | DUF932 domain-containing protein | - |
| OUI59_RS24435 (OUI59_24435) | 4965653..4966126 | - | 474 | WP_126766064.1 | hypothetical protein | - |
| OUI59_RS24440 (OUI59_24440) | 4966197..4966649 | - | 453 | WP_126766061.1 | hypothetical protein | - |
| OUI59_RS24445 (OUI59_24445) | 4966685..4967401 | - | 717 | WP_126766059.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4958009..4998214 | 40205 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12148.90 Da Isoelectric Point: 6.3215
>T266057 WP_126765581.1 NZ_CP113789:c4963108-4962788 [Klebsiella variicola subsp. tropica]
MHISSVPATVPVSSRLPPVQVWQQLLTYLLEHHYGLMLNDTPFHDDTAIQEHIEAGITLADAVNFLVERYELVRTYRKGF
SWQEQTPFLTAVDILRARRATGLMNT
MHISSVPATVPVSSRLPPVQVWQQLLTYLLEHHYGLMLNDTPFHDDTAIQEHIEAGITLADAVNFLVERYELVRTYRKGF
SWQEQTPFLTAVDILRARRATGLMNT
Download Length: 321 bp
Antitoxin
Download Length: 115 a.a. Molecular weight: 12794.49 Da Isoelectric Point: 6.4666
>AT266057 WP_047037235.1 NZ_CP113789:c4963489-4963145 [Klebsiella variicola subsp. tropica]
MSNKTPSDHDVSEPWWGLERDITPCFGARLVQEGNRLHYLADRAGLAGSFSPEQLQKLDKAFPLYIDQLEAMLCSGELNP
RQRHQVSIHLTGLTCIADTRGSCGYVYLTIYPGR
MSNKTPSDHDVSEPWWGLERDITPCFGARLVQEGNRLHYLADRAGLAGSFSPEQLQKLDKAFPLYIDQLEAMLCSGELNP
RQRHQVSIHLTGLTCIADTRGSCGYVYLTIYPGR
Download Length: 345 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|