Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) shpAB/BrnT-BrnA
Location 4899298..4899874 Replicon chromosome
Accession NZ_CP113789
Organism Klebsiella variicola subsp. tropica strain BSK_177V2

Toxin (Protein)


Gene name shpA Uniprot ID -
Locus tag OUI59_RS24085 Protein ID WP_012542979.1
Coordinates 4899587..4899874 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name shpB Uniprot ID -
Locus tag OUI59_RS24080 Protein ID WP_100676437.1
Coordinates 4899298..4899600 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OUI59_RS24050 (OUI59_24050) 4894455..4894709 + 255 WP_061155890.1 DUF3343 domain-containing protein -
OUI59_RS24055 (OUI59_24055) 4894706..4895770 - 1065 WP_100730522.1 DUF2955 domain-containing protein -
OUI59_RS24060 (OUI59_24060) 4895760..4896827 - 1068 WP_100730523.1 HlyD family secretion protein -
OUI59_RS24065 (OUI59_24065) 4896834..4897298 - 465 WP_074387171.1 MarR family transcriptional regulator -
OUI59_RS24070 (OUI59_24070) 4897464..4897628 - 165 WP_100676435.1 DUF1127 domain-containing protein -
OUI59_RS24075 (OUI59_24075) 4897806..4899218 + 1413 WP_061155894.1 PLP-dependent aminotransferase family protein -
OUI59_RS24080 (OUI59_24080) 4899298..4899600 - 303 WP_100676437.1 BrnA antitoxin family protein Antitoxin
OUI59_RS24085 (OUI59_24085) 4899587..4899874 - 288 WP_012542979.1 BrnT family toxin Toxin
OUI59_RS24090 (OUI59_24090) 4900041..4900460 - 420 WP_100676438.1 FosA5 family fosfomycin resistance glutathione transferase -
OUI59_RS24095 (OUI59_24095) 4900454..4901362 - 909 WP_074387174.1 LysR family transcriptional regulator -
OUI59_RS24100 (OUI59_24100) 4901449..4902231 + 783 WP_074387175.1 NAD(P)H-dependent oxidoreductase -
OUI59_RS24105 (OUI59_24105) 4902373..4902957 + 585 WP_064180527.1 TetR/AcrR family transcriptional regulator -
OUI59_RS24110 (OUI59_24110) 4902979..4903782 + 804 WP_074387176.1 winged helix-turn-helix domain-containing protein -
OUI59_RS24115 (OUI59_24115) 4903779..4904297 + 519 WP_100676439.1 FidL-like protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(7-88)

Antitoxin

BrnA antitoxin of type II toxin-antitoxin system

(38-93)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11245.77 Da        Isoelectric Point: 8.6574

>T266056 WP_012542979.1 NZ_CP113789:c4899874-4899587 [Klebsiella variicola subsp. tropica]
MPMEFEWDANKALSNLRKHGVRFEEAVLVFDDPRHLSRQERFENGEYRWQTIGLVHGILVILVAHSVRFESGTEVIRIIS
ARKADRKERNRYEHG

Download         Length: 288 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11382.04 Da        Isoelectric Point: 9.9256

>AT266056 WP_100676437.1 NZ_CP113789:c4899600-4899298 [Klebsiella variicola subsp. tropica]
MSMVKHKRDNTAALTAMRDAELKALASKADEDIDYSDIPATDDAQWSDAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMIRDLNKK

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References