Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4293579..4294198 | Replicon | chromosome |
| Accession | NZ_CP113789 | ||
| Organism | Klebsiella variicola subsp. tropica strain BSK_177V2 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | OUI59_RS21220 | Protein ID | WP_002892050.1 |
| Coordinates | 4293980..4294198 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | OUI59_RS21215 | Protein ID | WP_074386716.1 |
| Coordinates | 4293579..4293953 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OUI59_RS21205 (OUI59_21205) | 4288735..4289928 | + | 1194 | WP_074386714.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OUI59_RS21210 (OUI59_21210) | 4289951..4293097 | + | 3147 | WP_074386715.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| OUI59_RS21215 (OUI59_21215) | 4293579..4293953 | + | 375 | WP_074386716.1 | Hha toxicity modulator TomB | Antitoxin |
| OUI59_RS21220 (OUI59_21220) | 4293980..4294198 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| OUI59_RS21225 (OUI59_21225) | 4294356..4294922 | + | 567 | WP_074386717.1 | maltose O-acetyltransferase | - |
| OUI59_RS21230 (OUI59_21230) | 4294894..4295025 | - | 132 | Protein_4170 | hypothetical protein | - |
| OUI59_RS21235 (OUI59_21235) | 4295059..4295529 | + | 471 | WP_061155526.1 | YlaC family protein | - |
| OUI59_RS21240 (OUI59_21240) | 4295498..4296955 | - | 1458 | WP_074386718.1 | PLP-dependent aminotransferase family protein | - |
| OUI59_RS21245 (OUI59_21245) | 4297056..4297754 | + | 699 | WP_074386719.1 | GNAT family protein | - |
| OUI59_RS21250 (OUI59_21250) | 4297751..4297891 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| OUI59_RS21255 (OUI59_21255) | 4297891..4298154 | - | 264 | WP_074386720.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T266055 WP_002892050.1 NZ_CP113789:4293980-4294198 [Klebsiella variicola subsp. tropica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14354.03 Da Isoelectric Point: 4.8989
>AT266055 WP_074386716.1 NZ_CP113789:4293579-4293953 [Klebsiella variicola subsp. tropica]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSADLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSADLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|