Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1858043..1858633 | Replicon | chromosome |
| Accession | NZ_CP113789 | ||
| Organism | Klebsiella variicola subsp. tropica strain BSK_177V2 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | OUI59_RS09090 | Protein ID | WP_074385360.1 |
| Coordinates | 1858301..1858633 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | OUI59_RS09085 | Protein ID | WP_074385359.1 |
| Coordinates | 1858043..1858300 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OUI59_RS09075 (OUI59_09075) | 1857351..1857544 | + | 194 | Protein_1777 | hypothetical protein | - |
| OUI59_RS09080 (OUI59_09080) | 1857571..1857642 | + | 72 | Protein_1778 | cell morphology transcriptional regulator XreR2 | - |
| OUI59_RS09085 (OUI59_09085) | 1858043..1858300 | + | 258 | WP_074385359.1 | antitoxin | Antitoxin |
| OUI59_RS09090 (OUI59_09090) | 1858301..1858633 | + | 333 | WP_074385360.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OUI59_RS09100 (OUI59_09100) | 1858956..1860392 | + | 1437 | WP_165784170.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| OUI59_RS09110 (OUI59_09110) | 1860898..1861200 | - | 303 | WP_061153979.1 | XRE family transcriptional regulator | - |
| OUI59_RS09115 (OUI59_09115) | 1861205..1861558 | - | 354 | WP_074385362.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OUI59_RS09120 (OUI59_09120) | 1862125..1862322 | + | 198 | WP_074385363.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11904.78 Da Isoelectric Point: 10.1840
>T266047 WP_074385360.1 NZ_CP113789:1858301-1858633 [Klebsiella variicola subsp. tropica]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGHFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVINEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGHFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVINEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|