Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 1717334..1717965 | Replicon | chromosome |
Accession | NZ_CP113789 | ||
Organism | Klebsiella variicola subsp. tropica strain BSK_177V2 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | OUI59_RS08520 | Protein ID | WP_074387014.1 |
Coordinates | 1717690..1717965 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OUI59_RS08515 | Protein ID | WP_022066422.1 |
Coordinates | 1717334..1717693 (-) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OUI59_RS08490 (OUI59_08490) | 1713591..1714535 | + | 945 | WP_074387017.1 | nickel ABC transporter permease subunit NikB | - |
OUI59_RS08495 (OUI59_08495) | 1714532..1715365 | + | 834 | WP_074387016.1 | nickel ABC transporter permease subunit NikC | - |
OUI59_RS08500 (OUI59_08500) | 1715365..1716129 | + | 765 | WP_023340796.1 | nickel import ATP-binding protein NikD | - |
OUI59_RS08505 (OUI59_08505) | 1716126..1716917 | + | 792 | WP_074387015.1 | nickel import ATP-binding protein NikE | - |
OUI59_RS08510 (OUI59_08510) | 1716905..1717306 | + | 402 | WP_048330886.1 | nickel-responsive transcriptional regulator NikR | - |
OUI59_RS08515 (OUI59_08515) | 1717334..1717693 | - | 360 | WP_022066422.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OUI59_RS08520 (OUI59_08520) | 1717690..1717965 | - | 276 | WP_074387014.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OUI59_RS08525 (OUI59_08525) | 1718362..1719375 | + | 1014 | WP_074387013.1 | magnesium transporter | - |
OUI59_RS08530 (OUI59_08530) | 1719415..1720608 | - | 1194 | WP_074387012.1 | NAD(P)/FAD-dependent oxidoreductase | - |
OUI59_RS08535 (OUI59_08535) | 1720839..1722335 | + | 1497 | WP_061153045.1 | inorganic phosphate transporter PitA | - |
OUI59_RS08540 (OUI59_08540) | 1722396..1722731 | - | 336 | WP_061153044.1 | universal stress protein UspB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10265.88 Da Isoelectric Point: 10.3165
>T266046 WP_074387014.1 NZ_CP113789:c1717965-1717690 [Klebsiella variicola subsp. tropica]
MDQQVLSLRNKQRHTLEQLFKIPVPQGIKWADIESLIKALGGEIKEGRGSRCKFLLNHSIASFHRPHPSPDTDKGAVESV
RDWLITIGVKP
MDQQVLSLRNKQRHTLEQLFKIPVPQGIKWADIESLIKALGGEIKEGRGSRCKFLLNHSIASFHRPHPSPDTDKGAVESV
RDWLITIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13294.99 Da Isoelectric Point: 4.4605
>AT266046 WP_022066422.1 NZ_CP113789:c1717693-1717334 [Klebsiella variicola subsp. tropica]
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQQEGEISLQEYLADCHEAGIEPYAHPEKLKT
FTLRYPESFGERLSSAAAEEQVSVNTWILETLNERLKQA
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQQEGEISLQEYLADCHEAGIEPYAHPEKLKT
FTLRYPESFGERLSSAAAEEQVSVNTWILETLNERLKQA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|