Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1191282..1191939 | Replicon | chromosome |
Accession | NZ_CP113789 | ||
Organism | Klebsiella variicola subsp. tropica strain BSK_177V2 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | OUI59_RS05775 | Protein ID | WP_002916310.1 |
Coordinates | 1191282..1191692 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | OUI59_RS05780 | Protein ID | WP_043520925.1 |
Coordinates | 1191673..1191939 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OUI59_RS05755 (OUI59_05755) | 1187282..1189015 | - | 1734 | WP_074387616.1 | single-stranded-DNA-specific exonuclease RecJ | - |
OUI59_RS05760 (OUI59_05760) | 1189021..1189734 | - | 714 | WP_061153358.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OUI59_RS05765 (OUI59_05765) | 1189757..1190653 | - | 897 | WP_268657690.1 | site-specific tyrosine recombinase XerD | - |
OUI59_RS05770 (OUI59_05770) | 1190754..1191275 | + | 522 | WP_008806427.1 | flavodoxin FldB | - |
OUI59_RS05775 (OUI59_05775) | 1191282..1191692 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
OUI59_RS05780 (OUI59_05780) | 1191673..1191939 | - | 267 | WP_043520925.1 | FAD assembly factor SdhE | Antitoxin |
OUI59_RS05785 (OUI59_05785) | 1192185..1193168 | + | 984 | WP_100631278.1 | tRNA-modifying protein YgfZ | - |
OUI59_RS05790 (OUI59_05790) | 1193346..1194005 | - | 660 | WP_061153356.1 | hemolysin III family protein | - |
OUI59_RS05795 (OUI59_05795) | 1194169..1194480 | - | 312 | WP_074387613.1 | N(4)-acetylcytidine aminohydrolase | - |
OUI59_RS05800 (OUI59_05800) | 1194531..1195259 | + | 729 | WP_061156320.1 | MurR/RpiR family transcriptional regulator | - |
OUI59_RS05805 (OUI59_05805) | 1195379..1196812 | + | 1434 | WP_074387612.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T266044 WP_002916310.1 NZ_CP113789:c1191692-1191282 [Klebsiella variicola subsp. tropica]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|