Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 3154455..3155045 | Replicon | chromosome |
| Accession | NZ_CP113784 | ||
| Organism | Citrobacter freundii strain CFSAN077772 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A0J1NBD3 |
| Locus tag | OW080_RS14780 | Protein ID | WP_003836692.1 |
| Coordinates | 3154713..3155045 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A0J1NBD4 |
| Locus tag | OW080_RS14775 | Protein ID | WP_003836694.1 |
| Coordinates | 3154455..3154712 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OW080_RS14770 (3149942) | 3149942..3153841 | - | 3900 | WP_032936164.1 | hypothetical protein | - |
| OW080_RS14775 (3154455) | 3154455..3154712 | + | 258 | WP_003836694.1 | hypothetical protein | Antitoxin |
| OW080_RS14780 (3154713) | 3154713..3155045 | + | 333 | WP_003836692.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OW080_RS14790 (3155520) | 3155520..3156437 | + | 918 | WP_003030855.1 | nitrogen assimilation transcriptional regulator NAC | - |
| OW080_RS14795 (3156539) | 3156539..3157489 | + | 951 | WP_003846751.1 | HTH-type transcriptional regulator Cbl | - |
| OW080_RS14805 (3157805) | 3157805..3159292 | - | 1488 | WP_003846749.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3135113..3166480 | 31367 | |
| - | inside | Genomic island | - | - | 3135113..3167488 | 32375 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11703.48 Da Isoelectric Point: 8.5572
>T266038 WP_003836692.1 NZ_CP113784:3154713-3155045 [Citrobacter freundii]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1NBD3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1NBD4 |