Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2468502..2469122 | Replicon | chromosome |
Accession | NZ_CP113784 | ||
Organism | Citrobacter freundii strain CFSAN077772 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | OW080_RS11615 | Protein ID | WP_002892050.1 |
Coordinates | 2468502..2468720 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | OW080_RS11620 | Protein ID | WP_003021733.1 |
Coordinates | 2468748..2469122 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OW080_RS11580 (2463735) | 2463735..2464364 | + | 630 | WP_032936969.1 | membrane protein | - |
OW080_RS11585 (2464429) | 2464429..2464782 | + | 354 | WP_003831033.1 | DUF1428 family protein | - |
OW080_RS11590 (2464834) | 2464834..2466387 | - | 1554 | WP_048241431.1 | EAL domain-containing protein | - |
OW080_RS11595 (2466576) | 2466576..2466836 | + | 261 | WP_003835926.1 | type B 50S ribosomal protein L31 | - |
OW080_RS11600 (2466838) | 2466838..2466978 | + | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
OW080_RS11605 (2467057) | 2467057..2467527 | - | 471 | WP_003021724.1 | YlaC family protein | - |
OW080_RS11610 (2467644) | 2467644..2468195 | - | 552 | WP_032936967.1 | maltose O-acetyltransferase | - |
OW080_RS11615 (2468502) | 2468502..2468720 | - | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
OW080_RS11620 (2468748) | 2468748..2469122 | - | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
OW080_RS11625 (2469611) | 2469611..2472760 | - | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
OW080_RS11630 (2472783) | 2472783..2473976 | - | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T266037 WP_002892050.1 NZ_CP113784:c2468720-2468502 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT266037 WP_003021733.1 NZ_CP113784:c2469122-2468748 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |