Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 2201741..2202420 | Replicon | chromosome |
Accession | NZ_CP113784 | ||
Organism | Citrobacter freundii strain CFSAN077772 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A1B7JLK7 |
Locus tag | OW080_RS10370 | Protein ID | WP_003031349.1 |
Coordinates | 2201741..2202082 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | A0A1B7JLJ2 |
Locus tag | OW080_RS10375 | Protein ID | WP_003031347.1 |
Coordinates | 2202103..2202420 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OW080_RS10345 (2197485) | 2197485..2198216 | + | 732 | WP_016149623.1 | winged helix-turn-helix domain-containing protein | - |
OW080_RS10350 (2198191) | 2198191..2198664 | + | 474 | WP_003838775.1 | hypothetical protein | - |
OW080_RS10355 (2199006) | 2199006..2200454 | + | 1449 | WP_016149624.1 | EAL domain-containing protein | - |
OW080_RS10360 (2200647) | 2200647..2201111 | + | 465 | WP_003843778.1 | isoprenylcysteine carboxylmethyltransferase family protein | - |
OW080_RS10370 (2201741) | 2201741..2202082 | - | 342 | WP_003031349.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
OW080_RS10375 (2202103) | 2202103..2202420 | - | 318 | WP_003031347.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OW080_RS10380 (2202438) | 2202438..2202659 | - | 222 | WP_003031346.1 | DUF987 domain-containing protein | - |
OW080_RS10385 (2202668) | 2202668..2203144 | - | 477 | WP_003031345.1 | RadC family protein | - |
OW080_RS10390 (2203160) | 2203160..2203621 | - | 462 | WP_003031344.1 | antirestriction protein | - |
OW080_RS10395 (2204330) | 2204330..2206327 | + | 1998 | WP_032939120.1 | choline BCCT transporter BetT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12921.01 Da Isoelectric Point: 9.6543
>T266036 WP_003031349.1 NZ_CP113784:c2202082-2201741 [Citrobacter freundii]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JLK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JLJ2 |