Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1766728..1767244 | Replicon | chromosome |
Accession | NZ_CP113784 | ||
Organism | Citrobacter freundii strain CFSAN077772 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0J1MTE6 |
Locus tag | OW080_RS08380 | Protein ID | WP_016149473.1 |
Coordinates | 1766960..1767244 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0J1MV10 |
Locus tag | OW080_RS08375 | Protein ID | WP_003839576.1 |
Coordinates | 1766728..1766970 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OW080_RS08355 (1761743) | 1761743..1762876 | + | 1134 | WP_048241739.1 | amidohydrolase/deacetylase family metallohydrolase | - |
OW080_RS08360 (1762860) | 1762860..1763978 | + | 1119 | WP_003025770.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
OW080_RS08365 (1763975) | 1763975..1764715 | + | 741 | WP_003025772.1 | KDGP aldolase family protein | - |
OW080_RS08370 (1764737) | 1764737..1766650 | + | 1914 | WP_048241736.1 | BglG family transcription antiterminator | - |
OW080_RS08375 (1766728) | 1766728..1766970 | + | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OW080_RS08380 (1766960) | 1766960..1767244 | + | 285 | WP_016149473.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OW080_RS08385 (1767248) | 1767248..1767712 | - | 465 | WP_032937736.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OW080_RS08390 (1767819) | 1767819..1769957 | - | 2139 | WP_003839582.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OW080_RS08395 (1770335) | 1770335..1770919 | - | 585 | WP_003839584.1 | fructose PTS transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10878.73 Da Isoelectric Point: 10.0482
>T266035 WP_016149473.1 NZ_CP113784:1766960-1767244 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MTE6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MV10 |