Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 1510869..1511535 | Replicon | chromosome |
Accession | NZ_CP113784 | ||
Organism | Citrobacter freundii strain CFSAN077772 |
Toxin (Protein)
Gene name | tad | Uniprot ID | A0A0J1MRN0 |
Locus tag | OW080_RS07165 | Protein ID | WP_032938228.1 |
Coordinates | 1510869..1511228 (+) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | A0A0J1QJH0 |
Locus tag | OW080_RS07170 | Protein ID | WP_032938223.1 |
Coordinates | 1511218..1511535 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OW080_RS07155 (1508269) | 1508269..1509900 | + | 1632 | WP_032938230.1 | Na/Pi cotransporter family protein | - |
OW080_RS07160 (1509966) | 1509966..1510655 | - | 690 | WP_003841421.1 | dipeptidase PepE | - |
OW080_RS07165 (1510869) | 1510869..1511228 | + | 360 | WP_032938228.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OW080_RS07170 (1511218) | 1511218..1511535 | + | 318 | WP_032938223.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OW080_RS07175 (1511675) | 1511675..1511836 | - | 162 | WP_003841416.1 | phage protein | - |
OW080_RS07180 (1511907) | 1511907..1512080 | - | 174 | WP_032938222.1 | hypothetical protein | - |
OW080_RS07185 (1512212) | 1512212..1512568 | + | 357 | WP_032938220.1 | hypothetical protein | - |
OW080_RS07190 (1512618) | 1512618..1513430 | - | 813 | WP_048241809.1 | shikimate 5-dehydrogenase | - |
OW080_RS07195 (1513432) | 1513432..1514655 | - | 1224 | WP_048241807.1 | L-sorbose 1-phosphate reductase | - |
OW080_RS07200 (1514724) | 1514724..1515548 | - | 825 | WP_003031641.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
OW080_RS07205 (1515560) | 1515560..1516357 | - | 798 | WP_003841402.1 | PTS mannose/fructose/sorbose transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13411.37 Da Isoelectric Point: 10.3350
>T266034 WP_032938228.1 NZ_CP113784:1510869-1511228 [Citrobacter freundii]
MTKPLYWVGHARKDLQGMPEHVRDTFGFALWLAQQGKQHSQTKSLKGFGGAGVLEVVEDHHGNAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
MTKPLYWVGHARKDLQGMPEHVRDTFGFALWLAQQGKQHSQTKSLKGFGGAGVLEVVEDHHGNAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MRN0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1QJH0 |