Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 1355333..1355949 | Replicon | chromosome |
| Accession | NZ_CP113784 | ||
| Organism | Citrobacter freundii strain CFSAN077772 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A0J1MQ96 |
| Locus tag | OW080_RS06445 | Protein ID | WP_003028682.1 |
| Coordinates | 1355575..1355949 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6B5NTK4 |
| Locus tag | OW080_RS06440 | Protein ID | WP_043018956.1 |
| Coordinates | 1355333..1355575 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OW080_RS06415 (1351183) | 1351183..1351782 | + | 600 | WP_003028663.1 | glucose-1-phosphatase | - |
| OW080_RS06420 (1351776) | 1351776..1352648 | + | 873 | WP_269019838.1 | virulence factor BrkB family protein | - |
| OW080_RS06425 (1352645) | 1352645..1353082 | + | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
| OW080_RS06430 (1353127) | 1353127..1354068 | + | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
| OW080_RS06435 (1354219) | 1354219..1355127 | - | 909 | WP_003847901.1 | alpha/beta hydrolase | - |
| OW080_RS06440 (1355333) | 1355333..1355575 | + | 243 | WP_043018956.1 | CopG family transcriptional regulator | Antitoxin |
| OW080_RS06445 (1355575) | 1355575..1355949 | + | 375 | WP_003028682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OW080_RS06450 (1355986) | 1355986..1356915 | - | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| OW080_RS06455 (1356912) | 1356912..1357547 | - | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OW080_RS06460 (1357544) | 1357544..1358446 | - | 903 | WP_003847898.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13674.89 Da Isoelectric Point: 9.5622
>T266033 WP_003028682.1 NZ_CP113784:1355575-1355949 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1MQ96 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6B5NTK4 |