266031

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 894892..895478 Replicon chromosome
Accession NZ_CP113784
Organism Citrobacter freundii strain CFSAN077772

Toxin (Protein)


Gene name doc Uniprot ID A0A0J1QS94
Locus tag OW080_RS04240 Protein ID WP_032937237.1
Coordinates 894892..895260 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0J1N092
Locus tag OW080_RS04245 Protein ID WP_032937236.1
Coordinates 895257..895478 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OW080_RS04220 (890429) 890429..891499 - 1071 WP_003837845.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
OW080_RS04225 (891502) 891502..892347 - 846 WP_003023450.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OW080_RS04230 (892344) 892344..893231 - 888 WP_032937238.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OW080_RS04235 (893332) 893332..894648 - 1317 WP_003023445.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OW080_RS04240 (894892) 894892..895260 - 369 WP_032937237.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OW080_RS04245 (895257) 895257..895478 - 222 WP_032937236.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OW080_RS04250 (895600) 895600..895881 - 282 WP_003023442.1 hypothetical protein -
OW080_RS04255 (895984) 895984..896697 - 714 WP_003827581.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OW080_RS04260 (896715) 896715..897482 - 768 WP_003023438.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OW080_RS04265 (897479) 897479..898756 - 1278 WP_003023436.1 branched chain amino acid ABC transporter permease LivM -
OW080_RS04270 (898753) 898753..899679 - 927 WP_003023435.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 889689..898756 9067
- inside Prophage - - 889689..906055 16366


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13617.91 Da        Isoelectric Point: 6.9891

>T266031 WP_032937237.1 NZ_CP113784:c895260-894892 [Citrobacter freundii]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIVLSANPDFVAMTVEAAAGQLTLEQIAHRLRH

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8306.41 Da        Isoelectric Point: 4.7906

>AT266031 WP_032937236.1 NZ_CP113784:c895478-895257 [Citrobacter freundii]
MRTMNYSEARQNLAEVLESAVTGVPVTITRRGHKPAVIISAEEFERYQAARLDDEFADIMMIHGNEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J1QS94

Antitoxin

Source ID Structure
AlphaFold DB A0A0J1N092

References