Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 894892..895478 | Replicon | chromosome |
| Accession | NZ_CP113784 | ||
| Organism | Citrobacter freundii strain CFSAN077772 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A0J1QS94 |
| Locus tag | OW080_RS04240 | Protein ID | WP_032937237.1 |
| Coordinates | 894892..895260 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A0J1N092 |
| Locus tag | OW080_RS04245 | Protein ID | WP_032937236.1 |
| Coordinates | 895257..895478 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OW080_RS04220 (890429) | 890429..891499 | - | 1071 | WP_003837845.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
| OW080_RS04225 (891502) | 891502..892347 | - | 846 | WP_003023450.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| OW080_RS04230 (892344) | 892344..893231 | - | 888 | WP_032937238.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| OW080_RS04235 (893332) | 893332..894648 | - | 1317 | WP_003023445.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| OW080_RS04240 (894892) | 894892..895260 | - | 369 | WP_032937237.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| OW080_RS04245 (895257) | 895257..895478 | - | 222 | WP_032937236.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OW080_RS04250 (895600) | 895600..895881 | - | 282 | WP_003023442.1 | hypothetical protein | - |
| OW080_RS04255 (895984) | 895984..896697 | - | 714 | WP_003827581.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| OW080_RS04260 (896715) | 896715..897482 | - | 768 | WP_003023438.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| OW080_RS04265 (897479) | 897479..898756 | - | 1278 | WP_003023436.1 | branched chain amino acid ABC transporter permease LivM | - |
| OW080_RS04270 (898753) | 898753..899679 | - | 927 | WP_003023435.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 889689..898756 | 9067 | |
| - | inside | Prophage | - | - | 889689..906055 | 16366 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13617.91 Da Isoelectric Point: 6.9891
>T266031 WP_032937237.1 NZ_CP113784:c895260-894892 [Citrobacter freundii]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIVLSANPDFVAMTVEAAAGQLTLEQIAHRLRH
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIVLSANPDFVAMTVEAAAGQLTLEQIAHRLRH
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1QS94 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1N092 |