Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 491911..492590 | Replicon | chromosome |
| Accession | NZ_CP113784 | ||
| Organism | Citrobacter freundii strain CFSAN077772 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | OW080_RS02250 | Protein ID | WP_063200007.1 |
| Coordinates | 491911..492252 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | - |
| Locus tag | OW080_RS02255 | Protein ID | WP_063200004.1 |
| Coordinates | 492273..492590 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OW080_RS02230 (487954) | 487954..489003 | + | 1050 | WP_048242018.1 | YncE family protein | - |
| OW080_RS02235 (489014) | 489014..491011 | + | 1998 | WP_032937340.1 | TonB-dependent receptor | - |
| OW080_RS02240 (491042) | 491042..491548 | - | 507 | WP_016151005.1 | G/U mismatch-specific DNA glycosylase | - |
| OW080_RS02250 (491911) | 491911..492252 | - | 342 | WP_063200007.1 | TA system toxin CbtA family protein | Toxin |
| OW080_RS02255 (492273) | 492273..492590 | - | 318 | WP_063200004.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OW080_RS02260 (492609) | 492609..492830 | - | 222 | WP_001618789.1 | DUF987 domain-containing protein | - |
| OW080_RS02265 (492839) | 492839..493315 | - | 477 | WP_063199998.1 | RadC family protein | - |
| OW080_RS02270 (493331) | 493331..493789 | - | 459 | WP_063199995.1 | antirestriction protein | - |
| OW080_RS02275 (493891) | 493891..494130 | - | 240 | WP_063255812.1 | DUF905 domain-containing protein | - |
| OW080_RS02280 (494207) | 494207..494674 | - | 468 | WP_001547765.1 | protein YkfB | - |
| OW080_RS02285 (494703) | 494703..495140 | - | 438 | WP_063255811.1 | lipoprotein YafY | - |
| OW080_RS02290 (495140) | 495140..495376 | - | 237 | WP_063255810.1 | protein YpjK | - |
| OW080_RS02295 (495413) | 495413..496114 | - | 702 | WP_063255809.1 | WYL domain-containing protein | - |
| OW080_RS02300 (496331) | 496331..497152 | - | 822 | WP_063255808.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13107.16 Da Isoelectric Point: 9.6241
>T266030 WP_063200007.1 NZ_CP113784:c492252-491911 [Citrobacter freundii]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSEERVIQEHIDAGITLADAVNFLVEKYELVRIDRKEF
SWQEQSPYLRAVDILRARQVTGLLRQSRKNSVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSEERVIQEHIDAGITLADAVNFLVEKYELVRIDRKEF
SWQEQSPYLRAVDILRARQVTGLLRQSRKNSVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|