Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 333528..334182 | Replicon | chromosome |
Accession | NZ_CP113784 | ||
Organism | Citrobacter freundii strain CFSAN077772 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
Locus tag | OW080_RS01485 | Protein ID | WP_003026936.1 |
Coordinates | 333528..333935 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A6H3AT26 |
Locus tag | OW080_RS01490 | Protein ID | WP_003026938.1 |
Coordinates | 333916..334182 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OW080_RS01465 (329476) | 329476..331209 | - | 1734 | WP_032937435.1 | single-stranded-DNA-specific exonuclease RecJ | - |
OW080_RS01470 (331215) | 331215..331928 | - | 714 | WP_003825520.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OW080_RS01475 (331952) | 331952..332848 | - | 897 | WP_003026928.1 | site-specific tyrosine recombinase XerD | - |
OW080_RS01480 (332962) | 332962..333483 | + | 522 | WP_003026933.1 | flavodoxin FldB | - |
OW080_RS01485 (333528) | 333528..333935 | - | 408 | WP_003026936.1 | protein YgfX | Toxin |
OW080_RS01490 (333916) | 333916..334182 | - | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
OW080_RS01495 (334439) | 334439..335419 | + | 981 | WP_003838269.1 | tRNA-modifying protein YgfZ | - |
OW080_RS01500 (335513) | 335513..336172 | - | 660 | WP_003838267.1 | hemolysin III family protein | - |
OW080_RS01505 (336335) | 336335..336646 | - | 312 | WP_003026949.1 | N(4)-acetylcytidine aminohydrolase | - |
OW080_RS01510 (336699) | 336699..337427 | + | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
OW080_RS01515 (337548) | 337548..338981 | + | 1434 | WP_032937433.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T266029 WP_003026936.1 NZ_CP113784:c333935-333528 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NHY7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H3AT26 |