Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hipBA/HipA-couple_hipB |
Location | 4159176..4160753 | Replicon | chromosome |
Accession | NZ_CP113783 | ||
Organism | Pseudoxanthomonas sp. SE1 |
Toxin (Protein)
Gene name | hipA | Uniprot ID | - |
Locus tag | OY559_RS19435 | Protein ID | WP_277727937.1 |
Coordinates | 4159440..4160753 (+) | Length | 438 a.a. |
Antitoxin (Protein)
Gene name | hipB | Uniprot ID | - |
Locus tag | OY559_RS19430 | Protein ID | WP_277727935.1 |
Coordinates | 4159176..4159436 (+) | Length | 87 a.a. |
Genomic Context
Location: 4155322..4159032 (3711 bp)
Type: Others
Protein ID: WP_277727934.1
Type: Others
Protein ID: WP_277727934.1
Location: 4159176..4159436 (261 bp)
Type: Antitoxin
Protein ID: WP_277727935.1
Type: Antitoxin
Protein ID: WP_277727935.1
Location: 4159440..4160753 (1314 bp)
Type: Toxin
Protein ID: WP_277727937.1
Type: Toxin
Protein ID: WP_277727937.1
Location: 4161909..4162631 (723 bp)
Type: Others
Protein ID: WP_277727939.1
Type: Others
Protein ID: WP_277727939.1
Location: 4162628..4163059 (432 bp)
Type: Others
Protein ID: WP_277727940.1
Type: Others
Protein ID: WP_277727940.1
Location: 4154534..4155166 (633 bp)
Type: Others
Protein ID: WP_277727933.1
Type: Others
Protein ID: WP_277727933.1
Location: 4160862..4161647 (786 bp)
Type: Others
Protein ID: WP_277727938.1
Type: Others
Protein ID: WP_277727938.1
Location: 4163063..4163662 (600 bp)
Type: Others
Protein ID: WP_277727941.1
Type: Others
Protein ID: WP_277727941.1
Location: 4163662..4164495 (834 bp)
Type: Others
Protein ID: WP_277727942.1
Type: Others
Protein ID: WP_277727942.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OY559_RS19420 (OY559_19430) | 4154534..4155166 | - | 633 | WP_277727933.1 | tetratricopeptide repeat protein | - |
OY559_RS19425 (OY559_19435) | 4155322..4159032 | + | 3711 | WP_277727934.1 | indolepyruvate ferredoxin oxidoreductase family protein | - |
OY559_RS19430 (OY559_19440) | 4159176..4159436 | + | 261 | WP_277727935.1 | helix-turn-helix domain-containing protein | Antitoxin |
OY559_RS19435 (OY559_19445) | 4159440..4160753 | + | 1314 | WP_277727937.1 | type II toxin-antitoxin system HipA family toxin | Toxin |
OY559_RS19440 (OY559_19450) | 4160862..4161647 | - | 786 | WP_277727938.1 | hypothetical protein | - |
OY559_RS19445 (OY559_19455) | 4161909..4162631 | + | 723 | WP_277727939.1 | iron-containing redox enzyme family protein | - |
OY559_RS19450 (OY559_19460) | 4162628..4163059 | + | 432 | WP_277727940.1 | VOC family protein | - |
OY559_RS19455 (OY559_19465) | 4163063..4163662 | - | 600 | WP_277727941.1 | DUF938 domain-containing protein | - |
OY559_RS19460 (OY559_19470) | 4163662..4164495 | - | 834 | WP_277727942.1 | NYN domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4152504..4160753 | 8249 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 438 a.a. Molecular weight: 48674.75 Da Isoelectric Point: 7.8271
>T266028 WP_277727937.1 NZ_CP113783:4159440-4160753 [Pseudoxanthomonas sp. SE1]
MGELRIWMNGVEAATWQDAQPTRLTYVSSWLASSLARPLSLSLPLLPEGTSHRGDVVENYFDNLLPDSTNIRARLRNRFA
VPSNSTFALLEQIGRDCVGAIQLLPANTLPDEVRTIQARALDEAGVARLLRGVASPLLPGNHDGDSFRLSLAGAQEKTAL
LFHNGQWCVPLGSTPSTHIFKLPLGRVGNMRADMASSVENEWLCMQLLRAFGLPVANTSIGRFEELRVLVVERFDRRLSG
DGSWWIRLPQEDLCQVFGLPSSRKYENDGGPGVVQIMDLLRQSIEPRDREIFFKTQILFWLLAATDGHAKNFSLHIEPQG
RFRLTPLYDVLSVYPILGHGPQQLDPHEAVLAMSVVGKNKHRKLLNVRRRHWNETARACGVRHGAEPWLEDLLGRIEPAI
TSVAAQLPTDFPVEVAHAIFDGLRRAGDRLRGMAPGH
MGELRIWMNGVEAATWQDAQPTRLTYVSSWLASSLARPLSLSLPLLPEGTSHRGDVVENYFDNLLPDSTNIRARLRNRFA
VPSNSTFALLEQIGRDCVGAIQLLPANTLPDEVRTIQARALDEAGVARLLRGVASPLLPGNHDGDSFRLSLAGAQEKTAL
LFHNGQWCVPLGSTPSTHIFKLPLGRVGNMRADMASSVENEWLCMQLLRAFGLPVANTSIGRFEELRVLVVERFDRRLSG
DGSWWIRLPQEDLCQVFGLPSSRKYENDGGPGVVQIMDLLRQSIEPRDREIFFKTQILFWLLAATDGHAKNFSLHIEPQG
RFRLTPLYDVLSVYPILGHGPQQLDPHEAVLAMSVVGKNKHRKLLNVRRRHWNETARACGVRHGAEPWLEDLLGRIEPAI
TSVAAQLPTDFPVEVAHAIFDGLRRAGDRLRGMAPGH
Download Length: 1314 bp