Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 3404948..3405513 | Replicon | chromosome |
Accession | NZ_CP113783 | ||
Organism | Pseudoxanthomonas sp. SE1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OY559_RS16085 | Protein ID | WP_277727254.1 |
Coordinates | 3404948..3405268 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OY559_RS16090 | Protein ID | WP_277727255.1 |
Coordinates | 3405256..3405513 (-) | Length | 86 a.a. |
Genomic Context
Location: 3401576..3402289 (714 bp)
Type: Others
Protein ID: WP_277727250.1
Type: Others
Protein ID: WP_277727250.1
Location: 3402430..3403692 (1263 bp)
Type: Others
Protein ID: WP_277730031.1
Type: Others
Protein ID: WP_277730031.1
Location: 3403689..3404459 (771 bp)
Type: Others
Protein ID: WP_277727251.1
Type: Others
Protein ID: WP_277727251.1
Location: 3404573..3404941 (369 bp)
Type: Others
Protein ID: WP_277727253.1
Type: Others
Protein ID: WP_277727253.1
Location: 3407485..3408945 (1461 bp)
Type: Others
Protein ID: WP_277727259.1
Type: Others
Protein ID: WP_277727259.1
Location: 3408971..3409945 (975 bp)
Type: Others
Protein ID: WP_142125655.1
Type: Others
Protein ID: WP_142125655.1
Location: 3404948..3405268 (321 bp)
Type: Toxin
Protein ID: WP_277727254.1
Type: Toxin
Protein ID: WP_277727254.1
Location: 3405256..3405513 (258 bp)
Type: Antitoxin
Protein ID: WP_277727255.1
Type: Antitoxin
Protein ID: WP_277727255.1
Location: 3405532..3405909 (378 bp)
Type: Others
Protein ID: WP_277727256.1
Type: Others
Protein ID: WP_277727256.1
Location: 3405906..3406253 (348 bp)
Type: Others
Protein ID: WP_277727257.1
Type: Others
Protein ID: WP_277727257.1
Location: 3406332..3407315 (984 bp)
Type: Others
Protein ID: WP_277727258.1
Type: Others
Protein ID: WP_277727258.1
Location: 3409949..3410413 (465 bp)
Type: Others
Protein ID: WP_277727260.1
Type: Others
Protein ID: WP_277727260.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OY559_RS16065 (OY559_16075) | 3401576..3402289 | + | 714 | WP_277727250.1 | phosphoadenylyl-sulfate reductase | - |
OY559_RS16070 (OY559_16080) | 3402430..3403692 | + | 1263 | WP_277730031.1 | histidine kinase | - |
OY559_RS16075 (OY559_16085) | 3403689..3404459 | + | 771 | WP_277727251.1 | LytTR family DNA-binding domain-containing protein | - |
OY559_RS16080 (OY559_16090) | 3404573..3404941 | + | 369 | WP_277727253.1 | hypothetical protein | - |
OY559_RS16085 (OY559_16095) | 3404948..3405268 | - | 321 | WP_277727254.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OY559_RS16090 (OY559_16100) | 3405256..3405513 | - | 258 | WP_277727255.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OY559_RS16095 (OY559_16105) | 3405532..3405909 | - | 378 | WP_277727256.1 | DUF2809 domain-containing protein | - |
OY559_RS16100 (OY559_16110) | 3405906..3406253 | - | 348 | WP_277727257.1 | hypothetical protein | - |
OY559_RS16105 (OY559_16115) | 3406332..3407315 | - | 984 | WP_277727258.1 | LysR family transcriptional regulator | - |
OY559_RS16110 (OY559_16120) | 3407485..3408945 | + | 1461 | WP_277727259.1 | siroheme synthase CysG | - |
OY559_RS16115 (OY559_16125) | 3408971..3409945 | + | 975 | WP_142125655.1 | cysteine synthase A | - |
OY559_RS16120 (OY559_16130) | 3409949..3410413 | - | 465 | WP_277727260.1 | DUF6265 family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12200.20 Da Isoelectric Point: 10.1506
>T266027 WP_277727254.1 NZ_CP113783:c3405268-3404948 [Pseudoxanthomonas sp. SE1]
MVEIVWSEPALADLDAIADYIALDNRAAAVELVRRVFAHVDHLADHPDSGSRPPELKRGRYRQIVEPPCRVFYRSEPGRV
LLLHVMRSERLLRPGMLQARRPIKPR
MVEIVWSEPALADLDAIADYIALDNRAAAVELVRRVFAHVDHLADHPDSGSRPPELKRGRYRQIVEPPCRVFYRSEPGRV
LLLHVMRSERLLRPGMLQARRPIKPR
Download Length: 321 bp