Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4326838..4327619 | Replicon | chromosome |
Accession | NZ_CP113541 | ||
Organism | Salmonella enterica strain CHC |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | OXV05_RS20915 | Protein ID | WP_000626099.1 |
Coordinates | 4326838..4327329 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | OXV05_RS20920 | Protein ID | WP_001110452.1 |
Coordinates | 4327326..4327619 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV05_RS20880 (4322833) | 4322833..4323408 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
OXV05_RS20890 (4323679) | 4323679..4323756 | - | 78 | Protein_4085 | helix-turn-helix domain-containing protein | - |
OXV05_RS20895 (4323847) | 4323847..4324179 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
OXV05_RS20900 (4324251) | 4324251..4324628 | + | 378 | WP_000916345.1 | EthD family reductase | - |
OXV05_RS20905 (4325661) | 4325661..4325735 | + | 75 | Protein_4088 | porin family protein | - |
OXV05_RS20910 (4325838) | 4325838..4326590 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
OXV05_RS20915 (4326838) | 4326838..4327329 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
OXV05_RS20920 (4327326) | 4327326..4327619 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
OXV05_RS20925 (4327936) | 4327936..4328157 | + | 222 | WP_001576552.1 | hypothetical protein | - |
OXV05_RS20930 (4328422) | 4328422..4329297 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
OXV05_RS20935 (4329294) | 4329294..4329581 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
OXV05_RS20940 (4329604) | 4329604..4329819 | + | 216 | WP_001595136.1 | hypothetical protein | - |
OXV05_RS20945 (4329827) | 4329827..4330096 | + | 270 | WP_010989096.1 | hypothetical protein | - |
OXV05_RS20950 (4330390) | 4330390..4331295 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T266022 WP_000626099.1 NZ_CP113541:c4327329-4326838 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |