Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3433469..3434089 | Replicon | chromosome |
Accession | NZ_CP113541 | ||
Organism | Salmonella enterica strain CHC |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | OXV05_RS16735 | Protein ID | WP_001280991.1 |
Coordinates | 3433871..3434089 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | OXV05_RS16730 | Protein ID | WP_000344807.1 |
Coordinates | 3433469..3433843 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV05_RS16720 (3428608) | 3428608..3429801 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OXV05_RS16725 (3429824) | 3429824..3432973 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
OXV05_RS16730 (3433469) | 3433469..3433843 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
OXV05_RS16735 (3433871) | 3433871..3434089 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
OXV05_RS16740 (3434268) | 3434268..3434819 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
OXV05_RS16745 (3434936) | 3434936..3435406 | + | 471 | WP_000136181.1 | YlaC family protein | - |
OXV05_RS16750 (3435462) | 3435462..3435602 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
OXV05_RS16755 (3435608) | 3435608..3435868 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
OXV05_RS16760 (3436093) | 3436093..3437643 | + | 1551 | WP_268650649.1 | EAL domain-containing protein | - |
OXV05_RS16770 (3437874) | 3437874..3438263 | + | 390 | WP_000961285.1 | MGMT family protein | - |
OXV05_RS16775 (3438296) | 3438296..3438865 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T266017 WP_001280991.1 NZ_CP113541:3433871-3434089 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT266017 WP_000344807.1 NZ_CP113541:3433469-3433843 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|