Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 206531..207291 | Replicon | chromosome |
Accession | NZ_CP113541 | ||
Organism | Salmonella enterica strain CHC |
Toxin (Protein)
Gene name | tacT | Uniprot ID | Q57IH1 |
Locus tag | OXV05_RS00970 | Protein ID | WP_000533909.1 |
Coordinates | 206806..207291 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | M7RHS4 |
Locus tag | OXV05_RS00965 | Protein ID | WP_000965886.1 |
Coordinates | 206531..206818 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV05_RS00940 (201826) | 201826..202128 | + | 303 | WP_000605590.1 | YsaB family lipoprotein | - |
OXV05_RS00945 (202267) | 202267..203178 | + | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
OXV05_RS00950 (203188) | 203188..205257 | + | 2070 | WP_001291736.1 | glycine--tRNA ligase subunit beta | - |
OXV05_RS00955 (205439) | 205439..205714 | + | 276 | Protein_189 | IS3 family transposase | - |
OXV05_RS00960 (205886) | 205886..206353 | + | 468 | WP_000702452.1 | GNAT family N-acetyltransferase | - |
OXV05_RS00965 (206531) | 206531..206818 | + | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
OXV05_RS00970 (206806) | 206806..207291 | + | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
OXV05_RS00975 (207663) | 207663..208202 | - | 540 | WP_000047149.1 | copper-binding periplasmic metallochaperone CueP | - |
OXV05_RS00980 (208376) | 208376..208588 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
OXV05_RS00985 (208877) | 208877..209167 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
OXV05_RS00990 (209606) | 209606..210316 | + | 711 | WP_024159604.1 | DUF3053 domain-containing protein | - |
OXV05_RS00995 (210366) | 210366..211340 | - | 975 | WP_000804674.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
OXV05_RS01000 (211559) | 211559..212221 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T266006 WP_000533909.1 NZ_CP113541:206806-207291 [Salmonella enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7F36 | |
PDB | 7AK8 | |
PDB | 5FVJ |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK8 | |
AlphaFold DB | A0A3V2JDX2 |